Recombinant Magnaporthe oryzae Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
VMA21; MGG_09929; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
VMA21
Target Protein Sequence
MATRRIVATEKSILEKDDHIGSSPAAGEKSNITPAVPLDVILKLLAFTLAMVVIPIGSYF VTVNSIFKGNSTYAGALAAIMANVVLVAYVVVAMNEDQTEQEKAKEGKKDR
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is Magnaporthe oryzae and why is it significant in plant pathology?

Magnaporthe oryzae is an ascomycete fungus that exists in the haploid state and grows through branching hyphae. It spreads via tear-shaped, three-celled asexual conidia formed on aerial hyphae. This organism is a notorious plant pathogenic fungus responsible for rice blast disease, one of the most devastating diseases affecting rice crops globally. Beyond rice, it also infects other important cereal crops including wheat, barley, and millet . The economic significance of M. oryzae stems from its ability to cause severe crop losses, threatening food security in many regions where rice is a staple food.

The fungus has become a model organism for studying plant-pathogen interactions, with numerous regulatory mechanisms thoroughly investigated through advanced molecular biology technologies. Recent research has focused particularly on infection-related pathways and host defense mechanisms .

What is VMA21 and what role does it play in cellular function?

VMA21 (Vacuolar ATPase assembly integral membrane protein 21) is an essential assembly factor for the vacuolar-type H+-ATPase (V-ATPase). In yeast, VMA21 is an 8.5-kDa integral membrane protein that resides in the endoplasmic reticulum rather than being a component of the mature V-ATPase complex . The protein contains a dilysine motif at its carboxy terminus that mediates its retention in the endoplasmic reticulum .

Functionally, VMA21 is crucial for the proper assembly of the V-ATPase complex. In yeast vma21 mutants, the V-ATPase fails to assemble onto the vacuolar membrane, with peripheral subunits accumulating in the cytosol while the 100-kDa integral membrane subunit undergoes rapid degradation . This indicates that VMA21 plays a critical role in the assembly of the integral membrane sector of the V-ATPase in the endoplasmic reticulum.

How is recombinant M. oryzae VMA21 typically produced for research applications?

Recombinant M. oryzae VMA21 protein is typically produced using an E. coli expression system. The full-length protein (amino acids 1-111) is expressed with an N-terminal histidine tag to facilitate purification through affinity chromatography . The His-tagged protein allows for efficient single-step purification using immobilized metal affinity chromatography (IMAC).

The protein is supplied in lyophilized powder form with greater than 90% purity as determined by SDS-PAGE . This production method yields sufficient quantities of the protein for various research applications, including structural studies, interaction analyses, and functional assays.

What are the optimal storage and handling conditions for recombinant M. oryzae VMA21?

For optimal preservation of recombinant M. oryzae VMA21 protein activity, specific storage and handling protocols should be followed:

The lyophilized protein should be stored at -20°C or -80°C upon receipt. Prior to opening, the vial should be briefly centrifuged to bring the contents to the bottom. For reconstitution, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

For long-term storage, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the default concentration suggested by suppliers. The reconstituted protein should be aliquoted to minimize freeze-thaw cycles, as repeated freezing and thawing significantly reduces protein activity . Working aliquots can be stored at 4°C for up to one week to minimize degradation.

What functional assays can be used to study M. oryzae VMA21 activity?

Several experimental approaches can be employed to assess M. oryzae VMA21 functionality:

  • V-ATPase Assembly Assays: Monitor the assembly of V-ATPase complexes in the presence and absence of functional VMA21. This can be done through co-immunoprecipitation or blue native PAGE to visualize intact complexes.

  • Complementation Studies: Introduce M. oryzae VMA21 into yeast vma21 mutants to determine if it can rescue the V-ATPase assembly defect, which would indicate functional conservation.

  • Protein-Protein Interaction Assays: Techniques such as yeast two-hybrid analysis, similar to those used for AvrPi54 protein interactions , can identify binding partners of VMA21.

  • Subcellular Localization: Fluorescent tagging of VMA21 can determine its localization within fungal cells, particularly whether it resides in the endoplasmic reticulum as seen in yeast.

  • Phenotypic Assays: In VMA21-deficient or mutant strains, assess phenotypes related to V-ATPase function, such as pH sensitivity, growth rates, and morphological development.

How can researchers overcome challenges in working with membrane proteins like M. oryzae VMA21?

Working with membrane proteins presents several technical challenges:

Table 1: Strategies for Addressing Membrane Protein Research Challenges

ChallengeMethodological Solutions
Protein SolubilityUse of appropriate detergents (DDM, CHAPS); Solubilization screening to identify optimal conditions
Maintaining Native StructureInclusion of lipid nanodiscs or amphipols; Limited exposure to harsh detergents
Purification EfficiencyTandem affinity purification; Size exclusion chromatography following initial affinity purification
Functional AssessmentReconstitution into proteoliposomes; Microscale thermophoresis for interaction studies
Crystallization BarriersLipidic cubic phase crystallization; Use of antibody fragments to enhance crystal contacts

For structural studies, computational tools such as AlphaFold for structural prediction, molecular docking for interaction analysis, and molecular dynamics simulations can overcome the challenges associated with experimental structure determination of membrane proteins .

How might M. oryzae VMA21 contribute to fungal pathogenicity mechanisms?

The potential roles of VMA21 in M. oryzae pathogenicity are multifaceted:

V-ATPases are essential for maintaining pH homeostasis across cellular compartments, which is crucial for many aspects of fungal physiology including protein processing, vesicle trafficking, and enzyme activity. As an assembly factor for V-ATPases, VMA21 may indirectly influence these processes by ensuring proper V-ATPase function during infection.

During host infection, M. oryzae forms a specialized structure called an appressorium that generates enormous turgor pressure to breach the plant cell wall. The formation and function of this structure depend on proper vesicle trafficking and pH regulation, processes that require functional V-ATPases . VMA21 may therefore be essential for appressorium-mediated host penetration.

Additionally, secretion of effector proteins is a key mechanism by which M. oryzae manipulates host defenses. The secretory pathway depends on properly functioning V-ATPases for protein sorting and vesicle acidification. VMA21 dysfunction could potentially disrupt this secretion, affecting the delivery of fungal effectors to host cells .

How does M. oryzae VMA21 compare with VMA21 proteins in other organisms?

Comparative analysis of VMA21 across species reveals important evolutionary insights:

In yeast, VMA21 is characterized as an 8.5-kDa integral membrane protein retained in the endoplasmic reticulum through a C-terminal dilysine motif . The yeast protein plays a critical role in V-ATPase assembly, with vma21 mutants showing inability to assemble the V-ATPase complex onto the vacuolar membrane.

In humans, VMA21 mutations cause a range of clinical manifestations. Initially associated with X-linked myopathy with excessive autophagy, recent studies have shown that pathogenic variants in VMA21 can also lead to abnormal protein glycosylation, mild cholestasis, chronic elevation of aminotransferases, elevated LDL cholesterol, and hepatic steatosis . These conditions result from V-ATPase misassembly and dysfunction.

The M. oryzae VMA21 protein shares the fundamental role of facilitating V-ATPase assembly, but may have evolved specific adaptations related to the fungal lifestyle and pathogenicity. Sequence analysis and structural predictions could identify conserved domains that maintain the core assembly function while highlighting organism-specific features.

What structural biology approaches are most informative for studying M. oryzae VMA21?

Several structural biology techniques offer valuable insights into M. oryzae VMA21:

Cryo-electron microscopy (cryo-EM) and X-ray diffraction have been extensively utilized to explore the relationships between functional components in M. oryzae proteins . These techniques could elucidate the three-dimensional structure of VMA21 and its interactions with V-ATPase components.

Emerging computational tools offer promising alternatives. AlphaFold and similar AI-based structural prediction tools can generate reasonably accurate models of protein structures. Molecular docking can then be applied to analyze potential interactions between VMA21 and V-ATPase subunits. Molecular dynamics simulations can further refine these models by replicating in vivo conditions and dynamic protein behaviors .

What gene manipulation techniques can be used to study VMA21 function in M. oryzae?

Several genetic approaches can be employed to investigate VMA21 function in M. oryzae:

CRISPR-Cas9 Gene Editing: This technique allows precise modification of the VMA21 gene to create knockout mutants or introduce specific mutations. Phenotypic analysis of these mutants can reveal the biological consequences of VMA21 dysfunction.

RNA Interference (RNAi): By generating constructs that produce double-stranded RNA corresponding to VMA21, researchers can achieve post-transcriptional gene silencing to study the effects of reduced VMA21 expression.

Complementation Analysis: Similar to techniques used in studying AvrPi54 , genetic complementation can be performed by introducing functional VMA21 into mutant strains to confirm gene function.

Promoter Swapping: Replacing the native VMA21 promoter with inducible or tissue-specific promoters can help understand the temporal and spatial requirements for VMA21 expression during different stages of the fungal life cycle and infection process.

For transformation of M. oryzae, established protocols involve growing fungal mycelia in liquid complete medium, followed by protoplast generation and regeneration on specialized media such as TB3 (0.3% Yeast extract, 0.3% Casamino acid, 1.0% Glucose, 20% Sucrose, and 8% agar) .

How can understanding M. oryzae VMA21 contribute to rice blast disease management?

Research on M. oryzae VMA21 has significant implications for disease management strategies:

Detailed structural and functional characterization of VMA21 could identify potential vulnerabilities in the fungal lifecycle that might be targeted by novel antifungal compounds. If VMA21 function is essential for pathogenicity, it represents a promising target for disease control.

Structural biology approaches, including those mentioned in search result , can provide the foundation for structure-based drug design targeting VMA21 or its interactions with V-ATPase components. Such targeted approaches might yield fungicides with higher specificity and reduced environmental impact compared to conventional broad-spectrum fungicides.

Additionally, understanding the role of VMA21 in V-ATPase assembly and subsequent effects on fungal physiology might reveal novel aspects of M. oryzae biology that could inform broader disease management strategies, including cultural practices that exploit fungal weaknesses.

What techniques can assess the impact of VMA21 dysfunction on M. oryzae virulence?

Several experimental approaches can evaluate how VMA21 affects M. oryzae pathogenicity:

  • Plant Infection Assays: VMA21 mutant or silenced strains can be used to inoculate rice plants under controlled conditions to quantify changes in disease severity, lesion formation, and fungal biomass accumulation.

  • Appressorium Formation and Function: Microscopic examination of appressorium development, melanization, and penetration ability in VMA21-deficient strains can reveal specific defects in the infection process.

  • Effector Secretion Analysis: Monitoring the production and secretion of known M. oryzae effector proteins in VMA21 mutants can determine whether V-ATPase dysfunction affects the pathogen's ability to manipulate host defenses.

  • Stress Response Assessment: Evaluating how VMA21 mutants respond to various stresses encountered during infection (oxidative stress, pH changes, nutrient limitation) can identify specific pathways affected by VMA21 dysfunction.

  • Transcriptome and Proteome Analysis: Global analysis of gene expression and protein levels in VMA21 mutants during infection can identify downstream pathways affected by V-ATPase assembly defects.

Future research directions for M. oryzae VMA21 studies

Future investigations into M. oryzae VMA21 could productively focus on several promising areas:

  • Structural Determination: Resolving the three-dimensional structure of M. oryzae VMA21 using advanced structural biology techniques would provide crucial insights into its function and potential for targeted inhibition.

  • Interaction Network Mapping: Comprehensive identification of proteins that interact with VMA21 during V-ATPase assembly and fungal development could reveal additional targets for intervention.

  • Host-Pathogen Interface: Examining how V-ATPase function, influenced by VMA21, affects the secretion and activity of fungal effectors would enhance our understanding of pathogenicity mechanisms.

  • Comparative Analysis: Investigating functional differences between M. oryzae VMA21 and its counterparts in non-pathogenic fungi could highlight adaptations specific to the pathogenic lifestyle.

  • Targeted Inhibitor Development: Using structural information to design small molecules that specifically disrupt VMA21 function could lead to novel fungicide candidates with reduced environmental impact.

These research directions hold promise for advancing both fundamental understanding of fungal biology and applied approaches to managing rice blast disease, one of the most significant threats to global food security.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.