Recombinant Magnetococcus sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

ATP synthase is a vital enzyme that produces adenosine triphosphate (ATP), the primary energy currency in living organisms . In Mycobacterium tuberculosis (TB) and nontuberculous mycobacteria (NTM), ATP synthase is essential for viability, making it a validated drug target . The ATP synthase enzyme complex includes several subunits, one of which is subunit b (atpF). Understanding the structure, function, and regulation of these subunits is crucial for developing new anti-TB drugs and combating drug-resistant strains .

Functional Insights

Mutational studies of the subunits α and γ within the recombinant M. smegmatis F1-ATPase and F-ATP synthase demonstrate the importance of the αCTD and the γ-loop for latent ATP hydrolysis and ATP formation, respectively . Specifically, deletion of the αCTD in the recombinant MabF1-αΔ514-548βγε mutant enhanced ATP hydrolysis by 32-fold . The unique αCTD is the major ATP hydrolysis inhibitory element of F-ATP synthases of both TB-causing mycobacteria and NTM, and its interacting γ subunit may become an interesting inhibitor target since it is not present in the human counterpart, ensuring a lack of on-target toxicity .

Regulatory Mechanisms

The structure of ATP synthase from Mycobacterium smegmatis reveals an auto-inhibitory mechanism involving the C-terminal region of an α-subunit and a loop in the γ-subunit . This auto-inhibitory mechanism has been extended to involve the b′-subunit in the peripheral stalk, enhancing engagement. The fused bδ-subunit contains a duplicated domain in its N-terminal region where the two copies of the domain participate in similar modes of attachment of the two of three N-terminal regions of the α-subunits .

Role of the γ-Loop

The mycobacterial γ-loop is an attractive mycobacterial-wide drug target. Deletion of the γ166-179 loop in the recombinant MsF-ATP synthase resulted in a decrease of 43.2% in ATP synthesis . The interaction between *b’*R72 and the negatively charged γD170/γD171 is conserved across all mycobacterial species .

Drug Interactions

Bedaquiline (BDQ) targets mycobacterial ATP synthase, an essential enzyme in the obligate aerobic Mycobacterium genus . The drug-free structure reveals hook-like extensions from the enzyme’s α subunits that inhibit ATP hydrolysis in low-energy conditions. Bedaquiline binding induces global conformational changes in ATP synthase, creating tight binding pockets at the interface of subunits a and c .

Tables of Data

MutantATPase Activity (μmol min-1(mg protein)-1)
F1-αΔ514-548βγε1.28 ± 0.048
F1-αΔ532-548βγε0.36 ± 0.01
F1-αΔ542-548βγε0.54 ± 0.05
WT complex0.04
EnzymeATP Synthesis (nmol min-1(mg protein)-1)
Recombinant F-ATP synthase Δγ166-17914.4 ± 1.0

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
atpF; Mmc1_3676; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Target Names
atpF
Target Protein Sequence
MISAAYAATHAAAEHAQSGMPQFDSSTFSSQMFWTVISFVALLLLLKKFVVPAISDVLEA RASRIEEELKAAENERKEAAALLVDQRAEVKAEREKIAQLLESARKEADALREQEKAELE AELAKLKSQATQDIEQARRQAMSEVRGVVVEVALAVTEKLITKSIDKAEANKLADEAIRH LEANKDQLH
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembraneous) and the F0 membrane proton channel, linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing functional recombinant Magnetococcus sp. atpF?

Multiple expression systems have been successfully used for producing recombinant Magnetococcus sp. atpF, each with specific advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsBest For
E. coliHigh yield, cost-effective, rapid expressionMay lack post-translational modificationsStructural studies, antibody production
YeastEukaryotic processing, moderate yieldLonger production time than E. coliFunctional studies requiring folding assistance
BaculovirusHigh-level expression of complex proteinsRequires specialized equipmentStudies needing authentic folding
Mammalian cellsNative-like post-translational modificationsMost expensive, lower yieldsInteraction studies with host factors

For most basic biochemical and structural studies, E. coli-expressed recombinant atpF with N-terminal His-tag provides sufficient yield and purity (>90% by SDS-PAGE) . When designing expression constructs, researchers should consider whether full-length (1-189aa) or partial protein is required based on experimental goals .

What are the optimal storage and handling conditions for recombinant atpF protein?

Based on multiple product specifications, optimal storage and handling conditions include:

  • Storage temperature: -20°C to -80°C for long-term storage

  • Shelf life: Approximately 6 months for liquid formulations and 12 months for lyophilized forms at recommended temperatures

  • Reconstitution: For lyophilized protein, briefly centrifuge before opening, then reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Stabilization: Addition of glycerol to 5-50% final concentration (50% is commonly recommended) before aliquoting for long-term storage

  • Working conditions: Store working aliquots at 4°C for up to one week

  • Avoid: Repeated freeze-thaw cycles, which significantly reduce protein activity

For experimental reproducibility, it's advisable to prepare single-use aliquots immediately after initial reconstitution to minimize freeze-thaw damage to the protein structure.

How does the ATP synthase in magnetotactic bacteria differ structurally and functionally from other bacterial ATP synthases?

ATP synthase in magnetotactic bacteria like Magnetococcus sp. exhibits several unique structural and functional adaptations:

  • Specialized components: The ATP synthase complex in Magnetococcus marinus contains species-specific elements in subunits α, γ, and δ that distinguish it from other bacterial ATP synthases .

  • Self-inhibition mechanisms: Research on mycobacterial ATP synthases (with similar structure) shows the extended C-terminal domain (αCTD) of subunit α acts as the main element for self-inhibition of ATP hydrolysis. This may also apply to magnetotactic bacteria, allowing them to conserve energy in adverse conditions .

  • Rotation dynamics: The transition between inhibition states by the αCTD and active states appears to be a rapid process, potentially allowing magnetotactic bacteria to quickly respond to changing energy demands .

  • Energetic coupling: Unlike some bacterial ATP synthases that exclusively use H⁺ gradients, evidence suggests that the Magnetococcus ATP synthase may also utilize Na⁺ gradients in certain conditions, similar to what has been observed in other specialized bacteria like E. callanderi .

  • Integration with magnetosome formation: There may be unique energetic requirements for magnetosome formation that are supported by specialized functions of the ATP synthase complex, though direct experimental evidence linking atpF specifically to this process is limited in current literature .

These differences make the magnetotactic bacterial ATP synthase an attractive target for species-specific inhibitor discovery and evolutionary studies of specialized energy conservation mechanisms .

What methodological approaches can be used to study the interaction between atpF and other subunits in the ATP synthase complex?

Several approaches can be employed to investigate subunit interactions within the ATP synthase complex:

  • Co-immunoprecipitation with tagged recombinant atpF:

    • Express atpF with affinity tags (His, Avi-tag, etc.)

    • Perform pull-down assays to identify interaction partners

    • Analyze precipitated complexes using mass spectrometry

  • Cryo-EM structural analysis:

    • Purify intact ATP synthase complexes from native or recombinant sources

    • Perform single-particle cryo-EM analysis to visualize subunit arrangements

    • This approach has successfully revealed critical structural elements in mycobacterial F₁-ATPase and F₁F₀-ATP synthase with different nucleotide occupations

  • Cross-linking mass spectrometry (XL-MS):

    • Use chemical cross-linkers to capture transient protein-protein interactions

    • Digest cross-linked complexes and analyze by mass spectrometry

    • Map interaction interfaces between atpF and other subunits

  • Förster resonance energy transfer (FRET):

    • Create fluorescently labeled atpF and potential interaction partners

    • Measure energy transfer as indication of proximity

    • This can be used to study dynamic interactions during ATP synthesis/hydrolysis

  • Reconstitution experiments in liposomes:

    • Incorporate purified recombinant atpF with other ATP synthase components in artificial membrane systems

    • Measure functional outcomes (ATP synthesis) to assess proper complex formation

    • Similar approaches have been successful with ATP synthases from other species like E. callanderi

  • Yeast two-hybrid or bacterial two-hybrid screening:

    • Identify binary interactions between atpF and other subunits

    • Map interaction domains through truncation constructs

These methodologies can be combined to create a comprehensive understanding of how atpF contributes to ATP synthase assembly and function in magnetotactic bacteria.

How does ATP synthase function relate to magnetosome formation and organization in magnetotactic bacteria?

The relationship between ATP synthase function and magnetosome formation involves several interconnected processes:

  • Energy requirements for biomineralization:

    • Magnetosome formation is an energy-intensive process requiring ATP

    • The F₁F₀-ATP synthase provides the necessary energy currency for iron uptake, transport, and biomineralization of magnetite (Fe₃O₄) or greigite (Fe₃S₄)

    • ATP is needed for the functioning of proteins encoded by magnetosome gene clusters, including mam genes

  • Proton motive force (PMF) utilization:

    • Both ATP synthase and certain magnetosome formation processes utilize the proton motive force

    • The F₀ domain (containing atpF) is involved in proton translocation across the membrane, which may influence local pH important for biomineralization

  • Spatial organization:

    • Recent findings indicate ATP synthase complexes are assembled in mitochondria before being trafficked to specific cellular locations

    • Similar trafficking mechanisms may exist in magnetotactic bacteria for positioning ATP synthase near sites of magnetosome formation to provide localized ATP

  • MamK filament assembly:

    • MamK, an actin-like protein that organizes magnetosome chains, requires ATP for filament formation

    • ATP synthase may provide the ATP necessary for MamK assembly and proper magnetosome chain organization

    • Different Magnetococcus strains exhibit variations in magnetosome chain configuration, which may relate to energetic requirements provided by ATP synthase

  • Iron transport energetics:

    • ATP-dependent iron transporters are essential for supplying iron to magnetosomes

    • ATP synthase supplies the energy needed for these transporters to function

While direct experimental evidence specifically linking atpF to magnetosome formation is limited, the ATP synthase complex as a whole plays a crucial role in providing energy for the complex biomineralization processes in magnetotactic bacteria .

What approaches can be used to investigate the functional differences between ATP synthases from various magnetotactic bacteria species?

To investigate functional differences between ATP synthases from different magnetotactic bacteria species, researchers can employ these methodological approaches:

  • Comparative genomics and phylogenetic analysis:

    • Analyze sequences of ATP synthase subunits (including atpF) across different magnetotactic bacteria

    • Identify conserved and variable regions that may indicate functional adaptations

    • Use tools like GTDB-Tk for phylogenomic analyses similar to those used for Magnetococcales genomes

  • Heterologous expression and functional complementation:

    • Express ATP synthase genes from different magnetotactic species in model organisms

    • Assess functional complementation in ATP synthase-deficient strains

    • Similar approaches have been successful with MamK proteins from different magnetotactic bacteria

  • Reconstitution in liposomes with ion gradient measurements:

    • Purify ATP synthases from different magnetotactic bacteria

    • Reconstitute in liposomes and measure ATP synthesis under defined ion gradients

    • Test Na⁺ versus H⁺ dependence similar to experiments with E. callanderi ATP synthase

    • Determine minimum driving force (ΔμH⁺/F or ΔμNa⁺/F) required for ATP synthesis

  • Structural biology approaches:

    • Compare cryo-EM structures of ATP synthases from different magnetotactic bacteria

    • Identify structural elements that may contribute to species-specific functions

    • Focus on regions like the C-terminal domain of subunit α, known to be important in other bacterial ATP synthases

  • Site-directed mutagenesis of key residues:

    • Identify conserved and variable amino acids in atpF across magnetotactic bacteria

    • Create mutants to test functional importance of these residues

    • Assess impact on ATP synthesis/hydrolysis activities and coupling efficiency

  • Environmental adaptation studies:

    • Compare ATP synthase performance from different magnetotactic bacteria under various conditions (pH, temperature, salt)

    • Correlate functional differences with the environmental niches of source organisms

    • Similar to studies showing how culture medium affects Magnetospirillum magneticum properties

These approaches can reveal how evolutionary adaptations in ATP synthases contribute to the specialized energy metabolism of different magnetotactic bacteria species.

How can researchers measure the coupling efficiency between proton translocation and ATP synthesis in recombinant ATP synthase systems containing Magnetococcus sp. atpF?

Measuring coupling efficiency between proton translocation and ATP synthesis requires sophisticated biophysical techniques:

  • Reconstitution in proteoliposomes with fluorescent probes:

    • Incorporate purified recombinant ATP synthase containing atpF into liposomes

    • Include pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor internal pH changes

    • Generate defined proton gradients using techniques similar to those applied with E. callanderi ATP synthase

    • Simultaneously measure ATP synthesis rates using luciferase-based assays

    • Calculate H⁺/ATP ratio by correlating proton influx with ATP produced

  • Patch-clamp electrophysiology:

    • Form giant proteoliposomes or incorporate ATP synthase into planar lipid bilayers

    • Measure proton currents directly using patch-clamp techniques

    • Correlate electrical currents with ATP synthesis rates

  • Thermodynamic measurements:

    • Determine the minimum proton-motive force required for ATP synthesis

    • Create defined gradients using artificial systems (potassium/valinomycin)

    • Calculate thermodynamic efficiency by comparing actual ATP synthesis rates with theoretical maximum

    • As demonstrated with archeal ATP synthases, establish whether the enzyme can function at low driving forces (90-150 mV)

  • Inhibitor studies to assess proton pathway integrity:

    • Use specific inhibitors that target different components of the ATP synthase

    • Measure how these affect both proton translocation and ATP synthesis

    • Calculate coupling ratios under various inhibitory conditions

  • Site-directed mutagenesis of key residues in atpF:

    • Create mutations in conserved residues thought to be involved in proton translocation

    • Assess impact on coupling efficiency

    • Compare with similar mutations in other bacterial ATP synthases

  • Real-time measurements under varying conditions:

    • Develop systems to dynamically change proton gradients while measuring ATP synthesis

    • Determine response times and efficiency under non-equilibrium conditions

These methodologies can reveal how effectively the ATP synthase containing Magnetococcus sp. atpF couples proton movement to ATP synthesis, providing insights into the bioenergetics of these specialized bacteria.

What are the experimental challenges in studying the potential Na⁺ versus H⁺ specificity of Magnetococcus sp. ATP synthase?

Investigating ion specificity of Magnetococcus sp. ATP synthase presents several experimental challenges that researchers must address:

  • Establishing ion-specific gradients:

    • Challenge: Creating pure Na⁺ or H⁺ gradients without cross-contamination

    • Solution: Use ionophores with high selectivity (ETH2120 for Na⁺, CCCP for H⁺)

    • Methodology: Similar to experiments with E. callanderi ATP synthase, generate defined gradients using potassium diffusion potentials combined with specific ion concentrations

  • Membrane impermeability issues:

    • Challenge: Maintaining distinct ion gradients across membranes

    • Solution: Optimize lipid composition of proteoliposomes to minimize passive ion leakage

    • Control: Include experiments with protonophores (TCS) and sodium ionophores to confirm gradient dependence

  • Distinguishing primary from secondary ion dependencies:

    • Challenge: Determining if an observed Na⁺ effect is direct or indirect

    • Solution: Conduct experiments with varying Na⁺/H⁺ ratios while maintaining constant PMF

    • Analysis: Plot ATP synthesis rates as a function of [Na⁺] at constant ΔpH and Δψ

  • Protein stability during purification:

    • Challenge: Maintaining native conformation of atpF and the ATP synthase complex

    • Solution: Optimize detergent selection and purification conditions

    • Verification: Assess protein integrity using circular dichroism or tryptophan fluorescence

  • Site-directed mutagenesis of ion-binding sites:

    • Challenge: Identifying putative Na⁺-binding residues in atpF without crystal structure

    • Approach: Use homology modeling based on related ATP synthases with known Na⁺ specificity

    • Validation: Create mutants and test for altered ion specificity

  • Measuring ion binding directly:

    • Challenge: Low-affinity interactions are difficult to quantify

    • Techniques: ²²Na⁺ binding assays, isothermal titration calorimetry with specialized equipment

    • Analysis: Account for non-specific binding to protein and lipids

  • Designing functional assays with physiological relevance:

    • Challenge: In vitro conditions may not reflect cellular environment

    • Solution: Include physiologically relevant ion concentrations based on Magnetococcus ecology

    • Control: Compare results with ATP synthases of known ion specificity (Na⁺ or H⁺)

By addressing these challenges with appropriate experimental designs and controls, researchers can determine whether Magnetococcus sp. ATP synthase has evolved specificity for Na⁺, H⁺, or can utilize both ions under different conditions—information that would provide insights into its ecological adaptation and evolutionary history.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.