Recombinant Magnetococcus sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Overview of YidC Insertase

YidC is a universally conserved membrane protein insertase facilitating the integration of nascent polypeptides into lipid bilayers. It operates either independently or in concert with the Sec translocon, depending on substrate size and complexity . Key roles include:

  • Co-translational insertion of transmembrane domains (TMDs) into the cytoplasmic membrane .

  • Folding assistance for Sec-dependent substrates .

  • Coordination with SRP (signal recognition particle) for targeting hydrophobic substrates .

The Magnetococcus sp. YidC homolog shares the conserved five-transmembrane core structure critical for forming a hydrophilic cavity that guides substrate insertion .

Primary Structure

  • UniProt ID: A0LE49 .

  • Length: 556 amino acids .

  • Key Domains:

    • Five transmembrane helices (TM1–TM5), consistent with bacterial YidC architecture .

    • Cytoplasmic helical hairpin between TM2 and TM3, implicated in ribosome interaction .

Expression and Purification

  • Host System: Recombinant expression in Escherichia coli (inferred from standard practices).

  • Tag: Undisclosed affinity tag (determined during production) .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C or -80°C .

ParameterDetail
SpeciesMagnetococcus sp. (strain MC-1)
Molecular Weight~60 kDa (predicted)
Tag TypeAffinity tag (unspecified)
Storage BufferTris-based, 50% glycerol
ApplicationsELISA, structural studies

Mechanistic Role

  • Substrate Specificity: Facilitates insertion of small, Sec-independent membrane proteins (e.g., MscL, F0c) .

  • Collaboration with SecYEG: Assists in lateral clearance of TMDs from the Sec translocon .

  • Lipid Interaction: Hydrophobic slide (TM3 and TM5) mediates substrate integration at the protein-lipid interface .

In Vitro Utility

  • Membrane Protein Biogenesis Assays: Used to study insertion kinetics in proteoliposomes .

  • Foldase Activity: Validated in reconstituted systems for substrate folding .

Experimental Use Cases

  • ELISA Development: Employed as an antigen for antibody generation .

  • Structural Studies: Cryo-EM and molecular dynamics simulations to resolve insertion mechanisms .

  • Functional Complementation: Tests conservation across species by supplementing YidC-depleted bacterial strains .

Limitations

  • Species-Specific Data: Direct functional studies on Magnetococcus YidC remain sparse; most insights extrapolated from E. coli and Bacillus subtilis homologs .

Comparative Analysis with Other YidC Homologs

FeatureMagnetococcus sp. YidCE. coli YidCB. subtilis SpoIIIJ
Transmembrane Domains555
SRP InteractionLikely (inferred)Yes No
SecYEG CollaborationProbableYes Limited
Ribosome BindingNot confirmedYes Yes

Future Directions

  • Structural Resolution: High-resolution crystallography or cryo-EM to map substrate-binding regions.

  • Substrate Profiling: Identification of Magnetococcus-specific YidC clients via pull-down assays .

  • Biotechnological Engineering: Optimization for synthetic biology applications in membrane protein production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yidC; Mmc1_3757; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-556
Protein Length
full length protein
Species
Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Target Names
yidC
Target Protein Sequence
MDRRTLTAIVLSFVLLTAFQFYMAWKYPPAELTGEQVQSGESSAPAPLASTAPVADALPP PVEGMAGSAPQQAMSQPLINTDAKSLLHFKNDLVEGSLSLQGGRLVGMDFLQHTDVLGGK PISFMGISQVESFYQESGFLPVAGSAIKAPDANTQWQLIGKESLQGAGEFKLVWDNGEGI VFEKLFSFAQGSYLFKVEDRLINNSAAALGVYHYSQFKRIPVINSQSMLAMSDFQGPMAY LNGERYQHSYEDLTAQDLREKGHGGWTGFSDKYFLAAMVAKPLPPEAQPRRYYFDYDRPN YRVGMVENSVIIPAGQSLAVDYDLFIGPKEISTLERSNLSLERSIDYGWFHFLAEPLVKV LNFFNSVVHNYGVAIILLTLAIKLLFFPLANKSYRSMNAMKKLQPKIEELKKLHGSDRNK MNEAMMKLYQTHKVNPLGGCLPILVQIPVFFALYKVLFLSVEMRHAPFMLWIPDLSAMDP FYVLPLLMGGSMFLQSKLNPTPSDPMQAKIMMFLPVIFTVMFLSFPSGLVLYWLVNNVLS ISQQYYIMKKMEHEPS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. YidC is involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, and certain lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of YidC in bacterial membrane protein biogenesis?

YidC belongs to the YidC/Oxa1/Alb3 family of proteins that play essential roles in membrane protein insertion and folding across all domains of life. In bacteria, YidC facilitates the insertion of integral membrane proteins by functioning either independently as an insertase or in cooperation with the SecYEG translocon machinery.

YidC uses a channel-independent mechanism to insert certain membrane proteins, using a hydrophilic groove that is open to the cytosol and penetrates part-way into the membrane. This groove creates membrane distortion and thinning, which facilitates the passage of hydrophilic protein segments across the hydrophobic membrane barrier .

Unlike SecY, which forms a continuous hydrophilic pore across the membrane, YidC's hydrophilic groove only penetrates partially, creating a unique insertion mechanism that is energetically favorable for specific substrate proteins .

How do YidC homologs vary across bacterial species?

YidC homologs demonstrate significant structural conservation while exhibiting species-specific variations that affect substrate specificity and functional regulation:

OrganismYidC HomologsRegulation MechanismKey Features
E. coliSingle YidCConstitutive expressionWell-characterized for Pf3 coat protein insertion
B. subtilisTwo homologs: SpoIIIJ (YidC1) and YidC2 (YqjG)YidC1 expressed constitutively; YidC2 induced when YidC1 activity is compromisedRegulated by MifM-mediated translation arrest
Other bacteria (incl. Magnetococcus)Various homologsSpecies-dependentConserved hydrophilic groove and basic insertion mechanism

The dual YidC system in B. subtilis represents an adaptive mechanism to maintain membrane protein insertion capacity. When SpoIIIJ (YidC1) activity is limited, a regulatory nascent chain called MifM serves as a sensor that upregulates YidC2 expression through a sophisticated translation arrest mechanism .

What is the molecular mechanism of YidC-mediated membrane protein insertion?

The YidC-mediated insertion process involves several distinct molecular steps with specific conformational changes:

  • Initial substrate binding: Within approximately 2 milliseconds, the cytoplasmic α-helical hairpin of YidC binds the polypeptide substrate (such as Pf3 coat protein) with high conformational variability and kinetic stability .

  • Binding strengthening: Within 52 milliseconds, YidC strengthens its interaction with the substrate protein .

  • Transfer and insertion: YidC uses its cytoplasmic α-helical hairpin domain and hydrophilic groove to transfer the substrate to the membrane-inserted, folded state. During this phase, the substrate undergoes conformational changes to adapt to the YidC groove environment .

  • Conformational stabilization: In the inserted state, the substrate protein displays low conformational variability typical of transmembrane α-helical proteins .

Critical to this process is the hydrophilic transmembrane groove of YidC, which provides a protected environment for the substrate during insertion. The groove undergoes cycles of hydration and dehydration during the insertion process, and these dynamics are essential for facilitating the passage of hydrophilic segments of membrane proteins .

How do conformational changes in YidC correlate with substrate insertion efficiency?

MD simulations reveal that YidC undergoes significant conformational changes during the substrate insertion process, with different magnitudes of structural rearrangements at different stages:

  • Initial binding stage: YidC exhibits larger root mean square deviation (RMSD) values (approximately 2Å higher) compared to later stages, indicating substantial conformational flexibility during substrate recognition .

  • Progression of insertion: As insertion progresses, YidC shows reduced conformational fluctuations, suggesting stabilization of the insertase-substrate complex .

  • Substrate adaptation: The substrate protein (e.g., Pf3 coat protein) demonstrates changing bending angles as it adapts to the YidC groove environment, with lower bending at the start of insertion and increased bending as it moves deeper into the groove .

These observations suggest that the initial stages of insertion require greater conformational plasticity in YidC to accommodate diverse substrates, while later stages involve more stable interactions that guide the substrate into its final membrane-inserted conformation .

What are the optimal approaches for studying YidC-substrate interactions?

Current research employs multiple complementary techniques to investigate YidC-substrate interactions:

  • Single-molecule force spectroscopy: Allows measurement of binding forces between YidC and substrate proteins at the single-molecule level, providing insights into binding kinetics and strength .

  • Fluorescence spectroscopy: Enables tracking of conformational changes and spatial positioning during the insertion process .

  • Molecular dynamics simulations: Both equilibrium and non-equilibrium simulations (particularly targeted molecular dynamics) can model the complete insertion process and identify critical interaction points .

  • Reconstituted proteoliposomes: In vitro systems containing purified YidC, with or without additional components like MPIase and F0F1-ATPase, allow controlled investigation of insertion factor dependencies .

For comprehensive analysis, researchers should combine these approaches to capture both structural and dynamic aspects of YidC function. For example, in a pioneering study, researchers combined single-molecule force spectroscopy with fluorescence spectroscopy and MD simulations to elucidate the multi-step binding and insertion process of Pf3 coat protein .

How can researchers identify and characterize YidC-dependent substrates?

Identification and characterization of YidC-dependent substrates requires systematic analysis of membrane protein insertion under varying conditions:

  • YidC depletion systems: Use arabinose-dependent expression systems to modulate YidC levels and observe effects on insertion of candidate substrate proteins .

  • Mutational analysis: Create YidC variants with specific mutations (particularly in the third transmembrane segment, TM3) to identify regions critical for interaction with different substrates .

  • Charge distribution analysis: Examine the distribution of charged residues in potential substrate proteins, as mutations affecting charge (particularly negative to positive changes in N-terminal domains) can significantly impact YidC-dependent insertion .

  • Comparative insertion assays: Test insertion efficiency of the same substrate under different conditions (YidC-only, YidC+SecYEG, etc.) to determine the preferred insertion pathway .

Substrate PropertyCorrelation with YidC DependencyExperimental Approach
N-terminal chargeNegative charges favor YidC-dependent insertionCharge mutation analysis
Transmembrane segment hydrophobicityModerate hydrophobicity may require YidCHydrophobicity scaling and mutation
Size and topologySmall proteins with single TM segments often YidC-dependentTopology mapping with reporter fusions
Synthesis levelHigher synthesis levels may increase YidC dependencyControlled expression systems

How can researchers address inconsistent results in YidC insertion assays?

Inconsistent results in YidC insertion assays often stem from several common sources of variation:

  • Substrate-specific dependencies: Different substrates show varying dependencies on YidC, PMF (proton motive force), and accessory factors like MPIase. For example, Pf3-Lep is inserted independently of both YidC and PMF, whereas its V15D mutant requires both factors in vivo .

  • Synthesis level effects: The level of substrate protein synthesis can influence dependency on insertion factors. Some substrates may require YidC and PMF only when synthesis levels are elevated .

  • Membrane composition variations: Differences in lipid composition between natural membranes and reconstituted systems can affect insertion efficiency. Consider standardizing membrane composition in reconstituted systems.

  • Incomplete YidC depletion: Residual YidC activity in depletion systems may be sufficient for insertion of some substrates but not others, creating apparent inconsistencies.

To address these issues, researchers should:

  • Test multiple substrate concentrations

  • Verify complete YidC depletion using Western blotting

  • Include appropriate positive and negative controls

  • Consider the potential role of accessory factors like MPIase, which has been shown to be essential for insertion of both YidC-dependent and YidC-independent substrates in some systems

What are the critical considerations when designing YidC mutants for functional studies?

When designing YidC mutants for functional studies, researchers should consider:

  • Functional domains: The third transmembrane segment (TM3) is particularly crucial, as mutations in this region (e.g., C423R and P431L) can lead to cold-sensitive phenotypes with differential effects on various substrates .

  • Conserved residues: The conserved arginine residue (Arg75 in YidC2 of B. subtilis) within the intramembrane hydrophilic cavity is functionally indispensable and interacts with negatively charged residues in substrates .

  • Insertase-specific versus general effects: Some mutations may affect all insertion pathways while others may be specific to certain substrates or conditions. For example, the YidC(C423R) mutant exhibits a weak phenotype while YidC(P431L) produces a stronger phenotype, with both affecting Pf3 coat protein and ATP synthase F1Fo subunit c (FoC) insertion while having minimal effects on CyoA and wild-type procoat .

  • Temperature sensitivity: Consider testing mutant function at various temperatures, as some YidC mutations exhibit cold-sensitive phenotypes that provide valuable insights into function-structure relationships .

What is the evolutionary relationship between YidC and SecY translocase systems?

Recent structural analyses suggest that SecY and YidC may share a common evolutionary origin:

  • Structural similarities: Both SecY and YidC facilitate the diffusion of hydrophilic protein segments across the hydrophobic membrane by creating protected environments for these segments .

  • Evolutionary hypothesis: SecY may have originated as a YidC homolog that formed a channel by juxtaposing two hydrophilic grooves in an antiparallel homodimer .

  • Functional differences: While sharing a common evolutionary origin, the two systems have diverged in function. SecY forms a continuous hydrophilic pore across the membrane, while YidC's hydrophilic groove is only open to the cytosol and penetrates part-way into the membrane .

This evolutionary relationship suggests that membrane protein insertion mechanisms may have evolved from simpler, groove-based insertases like YidC to more complex channel-forming complexes like SecY, while maintaining both systems for different types of substrate proteins.

How do regulatory mechanisms of YidC expression vary across bacterial species?

Bacteria have evolved diverse mechanisms to regulate YidC expression and maintain membrane protein insertion capacity:

  • Single versus multiple homologs: Some bacteria express a single YidC protein constitutively, while others (like B. subtilis) maintain two homologs with one constitutively expressed and another induced under specific conditions .

  • MifM-based regulation in B. subtilis: This system employs an elegant nascent chain-based sensing mechanism. MifM contains:

    • An N-terminal transmembrane segment that serves as a substrate for SpoIIIJ/YidC1

    • A C-terminal arrest motif that interacts with the ribosomal exit tunnel

    When SpoIIIJ activity is limited, MifM membrane insertion fails, causing translation arrest that exposes the yidC2 Shine-Dalgarno sequence, allowing yidC2 translation .

  • Feedback regulation: In B. subtilis, YidC2 expression is subject to MifM-mediated autogenous feedback repression. YidC2 can insert MifM into the membrane and release its translation arrest, creating a self-regulating system .

This regulatory diversity reflects the critical importance of maintaining adequate membrane protein insertion capacity across different bacterial species and growth conditions.

What are the most promising approaches for manipulating YidC function for biotechnological applications?

Several promising research directions could exploit YidC function for biotechnology:

  • Engineered insertion systems: By understanding the substrate specificity determinants of YidC, researchers could design customized insertases for specific recombinant membrane proteins that are challenging to express.

  • Chimeric YidC proteins: Creating chimeras between YidC homologs from different species might generate insertases with novel substrate specificities or improved insertion efficiencies for biotechnological applications.

  • Co-expression strategies: Developing optimized co-expression systems for YidC and difficult-to-express membrane proteins could improve yields in membrane protein production.

  • Structure-guided YidC engineering: Using the detailed structural information now available, researchers could engineer YidC variants with enhanced stability or activity for membrane protein production systems.

The continued characterization of YidC mechanisms across diverse bacterial species, including Magnetococcus, will likely reveal additional strategies for manipulating this essential membrane protein insertion system.

How might environmental factors influence YidC-mediated insertion in different bacterial species?

Understanding environmental modulation of YidC function represents an important research frontier:

  • Temperature effects: Given the existence of cold-sensitive YidC mutants, temperature likely plays a significant role in modulating YidC function. Research into temperature adaptation of YidC across bacterial species from different thermal environments could reveal important functional principles .

  • Membrane composition effects: Lipid composition varies significantly across bacterial species and in response to environmental conditions. How these variations affect YidC-mediated insertion remains poorly understood.

  • Energy requirements: While some YidC-dependent insertions require proton motive force (PMF), others are PMF-independent. The environmental and substrate-specific determinants of these energy requirements warrant further investigation .

  • Stress responses: How bacterial stress responses modulate YidC activity and expression, particularly in species with multiple YidC homologs, represents an important area for future research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.