Recombinant Magnetococcus sp. Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Magnetococcus sp. Protein CrcB Homolog (crcB)

The Recombinant Magnetococcus sp. Protein CrcB homolog, referred to as crcB, is a protein derived from the Magnetococcus sp., specifically from strains like Magnetococcus marinus. This protein is often expressed in Escherichia coli (E. coli) for research purposes and is typically fused with an N-terminal His tag to facilitate purification and detection .

Amino Acid Sequence:

The amino acid sequence of the Recombinant Magnetococcus sp. Protein CrcB homolog is as follows:

MQIAWVALGGAIGAVARYVLSNAVYAWLGRAFPWGTLSVNLLGSFIMGLLFYLFTQRLMV PEALKPLVLVGGLGAFTTFSTFSLETLNLMQSGSWSLALLNMLSSVLLCVLAAYLGLVVG RLI .

Potential Applications:

  • Biotechnology: The unique properties of Magnetococcus species make them candidates for use in biotechnology applications, including environmental remediation and micro-robotics .

  • Scientific Research: Proteins like crcB can be used in studies related to protein structure and function, particularly in understanding the mechanisms of magnetotactic bacteria.

Future Directions:

Further research is needed to elucidate the specific functions and mechanisms of the crcB protein within Magnetococcus species. This could involve structural studies, functional assays, and exploration of its role in magnetotaxis or other cellular processes.

References:

  1. Recombinant Full Length Magnetococcus sp. Protein CrcB Homolog (crcB) Protein - Creative Biomart .

  2. ELISA Recombinant Magnetococcus sp. Protein CrcB Homolog (crcB) - Colorectal Research .

  3. Magnetococcus marinus: The Swimming Champion Bacterium - Max-Planck-Gesellschaft .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
crcB; Mmc1_1673; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Target Names
crcB
Target Protein Sequence
MQIAWVALGGAIGAVARYVLSNAVYAWLGRAFPWGTLSVNLLGSFIMGLLFYLFTQRLMV PEALKPLVLVGGLGAFTTFSTFSLETLNLMQSGSWSLALLNMLSSVLLCVLAAYLGLVVG RLI
Uniprot No.

Target Background

Function
Crucial in reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of the Recombinant Magnetococcus sp. Protein CrcB homolog (crcB)?

The CrcB homolog is primarily associated with chloride ion transport and homeostasis within bacterial cells, playing a critical role in maintaining ionic balance under stress conditions. It has been implicated in the regulation of intracellular ion concentrations, which is essential for cellular survival and function. In magnetotactic bacteria such as Magnetococcus sp., the protein may also contribute to magnetosome formation or biomineralization processes, although this specific role remains under investigation .

Experimental studies often involve isolating the protein and examining its activity in vitro using chloride ion flux assays or electrophysiological techniques. Genetic knockout experiments in Magnetococcus sp. can further elucidate its physiological importance by comparing wild-type strains with crcB-deficient mutants under varying environmental conditions .

How can the structure of the CrcB homolog be determined?

Determining the structure of the CrcB homolog involves a combination of computational modeling and experimental techniques such as X-ray crystallography or cryo-electron microscopy (cryo-EM). Computational tools like homology modeling can predict the tertiary structure based on known templates from related proteins. For experimental determination, researchers typically purify recombinant CrcB protein expressed in bacterial systems like Escherichia coli and crystallize it under optimized conditions.

High-resolution structural data provide insights into functional domains responsible for ion transport and potential binding sites for regulatory molecules. Moreover, comparative analyses with homologous proteins across different species can reveal conserved structural motifs critical for function .

What experimental approaches are used to study the gene expression of crcB in Magnetococcus sp.?

Gene expression analysis of crcB is commonly conducted using quantitative PCR (qPCR), RNA sequencing (RNA-seq), or reporter assays involving promoter fusion constructs. qPCR allows quantification of crcB mRNA levels under various environmental conditions, while RNA-seq provides a broader transcriptomic perspective, identifying co-regulated genes and pathways.

Promoter analysis using GFP or luciferase reporters can elucidate regulatory elements controlling crcB expression. Electrophoretic mobility shift assays (EMSAs) may further identify transcription factors binding to the crcB promoter region . These methods collectively help understand how crcB expression is modulated in response to external stimuli such as ionic stress or changes in magnetic fields.

What challenges arise when expressing recombinant CrcB protein in heterologous systems?

Expressing recombinant CrcB protein in heterologous systems like Escherichia coli often presents challenges related to solubility and functionality. Membrane proteins such as CrcB require specific lipid environments for proper folding and activity, which are difficult to replicate in non-native systems. Inclusion body formation is another common issue due to misfolding during overexpression.

To address these challenges, researchers may use specialized expression systems like insect cells or yeast that better mimic native lipid compositions. Co-expression with molecular chaperones or optimizing codon usage for host organisms can also enhance solubility and yield . Functional assays post-purification are critical to ensure that the recombinant protein retains its biological activity.

How does crcB contribute to magnetosome formation in Magnetococcus sp.?

While direct evidence linking crcB to magnetosome formation remains sparse, it is hypothesized that the protein may influence intracellular ionic conditions conducive to biomineralization processes. Magnetosomes are membrane-bound organelles containing magnetic iron minerals, and their formation requires tightly regulated ionic environments.

Genomic studies have identified clusters of genes involved in magnetosome assembly, often co-localized with crcB-like genes . Experimental approaches such as targeted gene deletions combined with phenotypic characterization under magnetic field gradients can clarify whether crcB plays a supportive role in magnetosome biogenesis.

What are the implications of sequence variations observed in crcB across different Magnetococcus strains?

Sequence variations in crcB across different strains may reflect adaptations to diverse environmental niches or functional specialization within magnetotactic bacteria populations. Comparative genomics studies reveal conserved motifs essential for chloride ion transport alongside strain-specific variations potentially linked to regulatory mechanisms .

Functional characterization of these variants involves site-directed mutagenesis followed by activity assays to assess their impact on ion transport efficiency or stress response capabilities. Structural studies comparing wild-type and mutant proteins can further elucidate how sequence differences translate into functional diversity .

How can contradictions between genomic predictions and experimental findings regarding crcB be resolved?

Contradictions between genomic predictions (e.g., inferred functions based on sequence homology) and experimental findings are not uncommon in protein research. Resolving these discrepancies requires integrative approaches combining computational modeling with empirical validation.

For example, if genomic data suggest a chloride transport function but experimental assays fail to detect activity, researchers might investigate alternative substrates or cofactors overlooked during initial experiments . Advanced techniques like mutagenesis screening or high-throughput ligand binding assays can provide additional clarity.

What role does crcB play in bacterial stress responses?

CrcB is implicated in bacterial stress responses by regulating intracellular chloride concentrations during osmotic or ionic stress conditions. This function helps maintain cellular homeostasis and prevents damage from extreme environmental fluctuations .

Stress response studies often involve exposing Magnetococcus sp. cultures to varying ionic strengths or osmotic pressures while monitoring crcB expression levels through qPCR or proteomic analyses. Mutant strains lacking functional crcB provide valuable controls for assessing its protective role during stress adaptation .

How can researchers investigate potential interactions between CrcB and other proteins?

Protein-protein interaction studies involving CrcB typically employ techniques such as co-immunoprecipitation (Co-IP), yeast two-hybrid screening, or proximity labeling methods like BioID (biotin identification). These approaches identify candidate interactors that may regulate or be regulated by CrcB.

Mass spectrometry-based proteomics following affinity purification provides high-confidence interaction networks that can be validated using genetic knockouts or biochemical assays . Functional studies on identified interactors help elucidate their roles within broader cellular pathways involving CrcB.

Are there any known post-translational modifications affecting CrcB activity?

Post-translational modifications (PTMs) such as phosphorylation or acetylation could potentially regulate CrcB activity, although direct evidence remains limited for this specific homolog . Proteomic analyses using mass spectrometry can identify PTMs on purified CrcB protein under different environmental conditions.

Functional assays comparing wild-type and PTM-deficient mutants provide insights into how these modifications influence ion transport efficiency or stress adaptation mechanisms . Further studies are needed to establish whether PTMs serve as regulatory switches for CrcB function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.