Recombinant Magnetococcus sp. Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Definition and General Function

Protein translocase subunit SecD is an integral membrane protein that functions as a key component of the bacterial protein translocation machinery. It operates in conjunction with other Sec translocon components to facilitate the movement of newly synthesized proteins across the bacterial cytoplasmic membrane. The Sec pathway represents the primary route for protein export in bacteria, with SecD playing a crucial role in the later stages of this process.

Based on research from other bacterial species, SecD typically functions alongside SecF, forming a complex known as SecDF. This complex enhances protein translocation across the membrane by utilizing the proton gradient as an energy source, functioning independently of the ATP-driven SecA motor . This dual-energy system ensures efficient protein transport across the bacterial membrane, critical for cellular survival and function.

Evolutionary Conservation

The SecD protein demonstrates wide conservation across bacterial species, highlighting its fundamental importance in bacterial physiology. The genes encoding SecD and SecF (secD and secF) have been identified in numerous bacterial and archaeal species, suggesting an ancient evolutionary origin of this protein translocation machinery .

Role in the Sec Translocon Complex

The Sec translocon functions as a protein-conducting channel composed primarily of the SecYEG complex, which forms the core translocation channel. SecD, along with SecF, associates with this core complex to enhance protein translocation efficiency. While SecYEG and SecA are essential for initiating protein translocation, SecDF is crucial for optimizing the process, particularly at the later stages.

Research has shown that SecDF functions at the periplasmic side of the membrane, independent of SecA. It appears to be involved in pulling precursor proteins from the SecYEG channel into the periplasmic space, utilizing the energy derived from the proton gradient across the membrane . This function complements the pushing mechanism of SecA, which operates from the cytoplasmic side using ATP hydrolysis.

Proton-Driven Mechanism

One of the most remarkable aspects of SecDF function is its utilization of the proton gradient as an energy source. Unlike SecA, which employs ATP hydrolysis, SecDF harnesses the proton motive force across the membrane to drive protein translocation.

Structural and functional analyses have revealed that the transmembrane region of SecDF conducts protons, while the periplasmic region interacts with the translocating protein . This suggests a mechanism where proton flow through the transmembrane domain drives conformational changes in the periplasmic domain, which in turn pulls the precursor protein through the membrane.

These conformational changes involve dramatic shifts in the orientation of the P1-head domain. Crystal structures have revealed different forms of SecDF, with these structures differing primarily in the orientation of the P1-head domain relative to the membrane and the P1-base domain. These structural transitions are believed to be crucial for the protein translocation function of SecDF .

The Sec Translocation Pathway

The Sec pathway is responsible for transporting a variety of proteins across the bacterial cytoplasmic membrane. These include periplasmic proteins, outer membrane proteins, and some integral membrane proteins. The process begins with the synthesis of a precursor protein containing a signal sequence that targets it to the Sec machinery.

In post-translational translocation, which is common in bacteria, newly synthesized proteins are maintained in an unfolded state by chaperones such as SecB. These chaperones target the precursor proteins to the membrane-associated SecA, which recognizes both the signal sequence and the SecYEG complex . Using energy from ATP hydrolysis, SecA repeatedly pushes segments of the precursor protein through the SecYEG channel.

Once the protein has partially traversed the membrane through the SecYEG channel, SecDF comes into play. It captures the emerging precursor protein on the periplasmic side and facilitates its complete translocation into the periplasm, even in the absence of continued SecA function . This dual-motor system ensures efficient protein translocation across the bacterial membrane.

Expression Systems for Bacterial Membrane Proteins

Producing recombinant membrane proteins like SecD presents significant challenges due to their hydrophobic nature and complex folding requirements. Various expression systems have been developed for bacterial membrane proteins, with Escherichia coli being the most commonly used host organism.

For the production of recombinant Magnetococcus sp. SecD, several expression systems could potentially be employed:

  1. Homologous expression in Magnetococcus sp. itself, which would provide the most native environment for proper folding and function.

  2. Heterologous expression in E. coli, which offers well-established protocols and high protein yields.

  3. Cell-free expression systems, which can sometimes overcome the toxicity issues associated with membrane protein overexpression.

Magnetotactic bacteria like Magnetococcus sp. can be genetically modified to express recombinant proteins, as demonstrated in studies with Magnetospirillum sp. strain MSR-1, where recombinant proteins were successfully expressed . This suggests potential for homologous expression of SecD in Magnetococcus sp.

Challenges and Strategies in Recombinant SecD Production

The production of recombinant membrane proteins like SecD faces several significant challenges:

  1. Toxicity to host cells: Overexpression of membrane proteins can disrupt membrane integrity and function, leading to growth inhibition or cell death.

  2. Protein misfolding and aggregation: The complex folding pathway of membrane proteins often leads to misfolding and aggregation when overexpressed.

  3. Low expression levels: Membrane proteins typically express at lower levels compared to soluble proteins.

  4. Difficulties in extraction and purification: The hydrophobic nature of membrane proteins requires detergents or other agents for extraction, adding complexity to the purification process.

To address these challenges, various strategies can be employed, including the use of fusion tags to enhance solubility, optimization of growth conditions, and the selection of appropriate detergents for extraction and purification.

Purification Methods for Recombinant SecD

Based on established protocols for similar proteins, purification of recombinant Magnetococcus sp. SecD would typically involve these steps:

  1. Cell lysis: Disruption of the host cells to release cellular contents.

  2. Membrane isolation: Separation of the membrane fraction containing the recombinant SecD.

  3. Solubilization: Extraction of the membrane protein using detergents or other solubilizing agents.

  4. Affinity chromatography: Purification based on a fusion tag, such as a histidine tag.

  5. Further purification: Size exclusion chromatography, ion exchange chromatography, or other methods to achieve high purity.

For recombinant Sec proteins, a common approach involves expression with an N-terminal histidine tag in E. coli, followed by affinity purification. The purified protein is often provided as a lyophilized powder in a Tris/PBS-based buffer containing trehalose for stability .

Characteristics of Known SecD Proteins

The table below compares the properties of known SecD proteins with predicted characteristics of Magnetococcus sp. SecD:

PropertyMycobacterium leprae SecDEscherichia coli SecDPredicted Magnetococcus sp. SecD
Length (amino acids)571 Approximately 550-570Likely 550-600
Amino acid sequenceBegins with MASSSAPVHFGRYLS... VariableUnknown, likely similar conservation pattern
Transmembrane regionsMultiplePart of 12 TM in SecDF complex Likely part of 12 TM in SecDF complex
Periplasmic domainsP1-head, P1-baseP1-head, P1-base, P4 Likely P1-head, P1-base, P4
Expression with SecFForms complexForms complex with SecF Likely forms complex with SecF
FunctionProtein translocationEnhances protein translocation Likely enhances protein translocation
Energy sourceProton gradientProton gradient Likely utilizes proton gradient
Purification approachHis-tagged, E. coli expression Various methodsLikely requires similar approaches

Functional Conservation and Variation

Despite sequence variations between bacterial species, the core function of SecD appears highly conserved. All known SecD proteins participate in enhancing protein translocation across the bacterial membrane by utilizing the proton gradient. The variations in sequence likely reflect adaptations to specific cellular environments, organism-specific protein substrates, or evolutionary divergence.

For Magnetococcus sp., a magnetotactic bacterium with specialized structures called magnetosomes, the SecD protein might show adaptations related to the translocation of proteins involved in magnetosome formation. These adaptations could include modifications in the substrate-binding regions or in the coupling mechanism between proton flow and protein movement.

Research Applications

Recombinant Magnetococcus sp. SecD offers several potential research applications:

  1. Structural studies: Determination of the high-resolution structure of SecD to understand its conformational dynamics during protein translocation.

  2. Functional studies: Investigation of the mechanism of SecD-enhanced protein translocation and its interplay with other components of the Sec machinery.

  3. Comparative analyses: Exploration of the differences and similarities between SecD from Magnetococcus sp. and other bacterial species, potentially revealing adaptations specific to magnetotactic bacteria.

  4. Interaction studies: Identification of protein-protein interactions between SecD and other components of the protein translocation machinery or substrate proteins.

Biotechnological Applications

The properties of recombinant SecD could be harnessed for various biotechnological applications:

  1. Protein production systems: Enhancement of secretion efficiency for recombinant proteins in bacterial expression systems.

  2. Membrane protein integration: Facilitation of the integration of difficult-to-express membrane proteins.

  3. Drug discovery: Development of new antibacterial agents targeting the protein translocation machinery.

  4. Magnetosome engineering: Potential applications in the engineering of magnetosomes for biotechnological purposes.

The table below summarizes potential applications of recombinant Magnetococcus sp. SecD:

Application CategorySpecific ApplicationsPotential Advantages
Structural BiologyX-ray crystallography, Cryo-EMMay reveal unique adaptations in magnetotactic bacteria
Protein Trafficking ResearchProtein translocation assaysCould provide insights into specialized translocation mechanisms
Antibacterial DevelopmentTarget for novel antimicrobialsMay offer species-specific targeting opportunities
BiotechnologyEnhancement of recombinant protein secretionCould improve yields in expression systems
Magnetosome ResearchStudy of protein translocation in magnetosome formationDirect relevance to understanding magnetotactic bacteria
Synthetic BiologyEngineering of protein secretion systemsMay provide tools for designed cellular functions

Knowledge Gaps

Several significant knowledge gaps remain regarding Magnetococcus sp. SecD:

  1. Sequence information: The specific amino acid sequence of Magnetococcus sp. SecD has not been well-documented in the scientific literature.

  2. Structural details: High-resolution structural information specific to Magnetococcus sp. SecD is lacking.

  3. Functional adaptations: The potential adaptations of SecD for the specialized functions of magnetotactic bacteria remain unexplored.

  4. Expression and purification protocols: Optimized methods specifically for Magnetococcus sp. SecD production need development.

Future Research Priorities

Future research on recombinant Magnetococcus sp. SecD should focus on:

  1. Gene identification and cloning: Identification and cloning of the secD gene from Magnetococcus sp.

  2. Expression and purification: Development of efficient protocols for the production of functional recombinant Magnetococcus sp. SecD.

  3. Structural determination: Elucidation of the three-dimensional structure using X-ray crystallography or cryo-electron microscopy.

  4. Functional characterization: Investigation of the protein translocation activity, proton-coupling mechanism, and substrate preferences.

  5. Role in magnetosome formation: Exploration of the potential involvement of SecD in the translocation of proteins required for magnetosome formation.

  6. Comparative analysis: Detailed comparison with SecD proteins from non-magnetotactic bacteria to identify unique features.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have a specific format preference, please indicate it in your order remarks. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
secD; Mmc1_3212; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Target Names
secD
Target Protein Sequence
MRQQPRWKLYLVVLVALGSIYYALPSLLGGNLPSWMPNKVIHQGLDLQGGLYLLYDVKVE EAIKQAGNNMVDSARNLLRKERQRYRGIEQVGADQVVIRLTPNSDTERMLSVLKDELRES KVEHFQPEAQIRLTLGEAEKVEIRKFAVDQAIEIIRNRIDAFGVSEPSIQKQGERRIIVQ LPGIKNPDRAKGLIGRTARLDFKLVNEKGDLNRALEGQVPADSELMYEERSANQGGKSAY PLLVFKRTILSGQHIQNAQTTFNEYNEPIVSVKFDAVGGRKFSQITGEHIKERLAIVLDG KVQSAPVIQDKIAGGRATISGSFTREEAHDLAIVLRAGALPAPLVILEERTVGPTLGADS VAQGLNSVLIGGVLVVLFMVLYYKGFGMLANLAVVLNVTILVSLLALMQATLTLPGIAGA VLLLGMAVDANVLIFERIREELRLGKSPLAAIDHGYSKAFSTILDANITTLITAVILYQF GTGPVRGFAVTLSVGLLASMFTAIFVTRVVLAEVVKNRRLKTLSI
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of SecD in the Sec translocon system of Magnetococcus sp.?

SecD functions as an accessory component of the bacterial Sec translocon, working in conjunction with SecF to enhance protein export efficiency. In Magnetococcus sp., as in other bacteria, SecD likely prevents backward movement of translocating proteins, effectively acting as a molecular ratchet during the later stages of translocation. The protein works in coordination with the proton motive force (PMF) to facilitate efficient protein export across the bacterial plasma membrane. While SecD is not part of the core translocon (composed primarily of SecY and SecE), it significantly enhances translocation efficiency by preventing backsliding of partially translocated proteins . Recent studies with other bacterial species have demonstrated that SecA, another key component of the Sec pathway, coordinates with the PMF to resolve periplasmic loops of inner membrane proteins during cotranslational translocation .

How does SecD in Magnetococcus sp. compare structurally to SecD in model organisms like E. coli?

The structural comparison between Magnetococcus sp. SecD and E. coli SecD reveals conservation in key functional domains while exhibiting species-specific adaptations. Both proteins contain characteristic membrane-spanning regions and large periplasmic domains. The periplasmic domain typically contains a P1 head domain and a P1 base domain that undergo conformational changes driven by the PMF. Magnetococcus sp., being a magnetotactic bacterium with specialized adaptations for magnetic field sensing and navigation , may exhibit unique structural features in SecD that accommodate its specialized protein export requirements. Experimental approaches to resolve these differences typically involve recombinant expression of both proteins, followed by structural characterization using X-ray crystallography or cryo-electron microscopy.

What techniques are most effective for analyzing SecD expression patterns in Magnetococcus sp.?

For analyzing SecD expression patterns in Magnetococcus sp., researchers should employ a multi-method approach:

  • qRT-PCR: For quantifying secD transcript levels under different environmental conditions or growth phases

  • Western blotting: Using anti-SecD antibodies to quantify protein levels

  • Fluorescent protein fusions: Creating SecD-GFP fusions to visualize localization in live cells

  • Ribosome profiling: To identify translational regulation of secD, similar to techniques used to study SecA-ribosome interactions

When conducting these experiments with Magnetococcus sp., researchers must consider the specialized growth conditions required for magnetotactic bacteria. These bacteria typically require microaerobic conditions and specific media formulations that support magnetosome formation. For optimal results, culture conditions similar to those used for Magnetospirillum gryphiswaldense can be adapted, including growth at 28°C in specialized medium supplemented with iron sources .

What expression systems are optimal for producing recombinant Magnetococcus sp. SecD?

The optimal expression system depends on experimental goals and downstream applications. For structural and functional studies of Magnetococcus sp. SecD, the following systems should be considered:

Expression SystemAdvantagesDisadvantagesTypical YieldBest For
E. coli BL21(DE3)High yield, simple culturePotential misfolding of membrane proteins2-5 mg/LInitial screening, mutagenesis studies
E. coli C43(DE3)Better for membrane proteinsLower yield than BL211-3 mg/LStructural studies
Cell-free systemAvoids toxicity issuesExpensive, lower yield0.5-1 mg/LDifficult-to-express variants
Homologous expressionNative folding and modificationsComplex methodology, lower yield0.1-0.5 mg/LFunctional studies

When expressing SecD, researchers should be mindful that overproduction of membrane proteins can saturate the Sec translocon capacity of the host organism, potentially affecting cell viability and protein yield . This challenge can be addressed by optimizing expression conditions, such as lowering induction temperature or using weaker promoters to reduce expression rate.

What purification strategy yields the highest purity and activity for recombinant Magnetococcus sp. SecD?

A multi-step purification approach is recommended for obtaining high-purity, active SecD:

  • Membrane isolation: Differential centrifugation to isolate bacterial membranes

  • Solubilization: Careful selection of detergents is critical; n-Dodecyl β-D-maltoside (DDM) at 1-2% is typically effective for SecD

  • Affinity chromatography: His-tagged SecD can be purified using Ni-NTA resin

  • Size exclusion chromatography: To remove aggregates and achieve high purity

For maintaining SecD activity during purification, it's essential to:

  • Keep samples at 4°C throughout the process

  • Include protease inhibitors to prevent degradation

  • Maintain optimal detergent concentration above the critical micelle concentration

  • Consider adding lipids during purification to stabilize the protein

The final purified SecD should be assessed for purity using SDS-PAGE and for activity using ATPase assays or protein translocation reconstitution experiments.

How does the proton motive force modulate SecD function in Magnetococcus sp.?

The proton motive force (PMF) plays a crucial role in SecD-mediated protein translocation. In Magnetococcus sp., as in other bacteria, SecD likely utilizes the energy from the PMF to undergo conformational changes that facilitate the forward movement of translocating proteins. Research indicates that SecA coordinates with the PMF to resolve periplasmic loops of inner membrane proteins during cotranslational translocation , suggesting a cooperative mechanism between different components of the Sec machinery.

To experimentally investigate this relationship, researchers can:

  • Use PMF uncouplers (CCCP or valinomycin) to disrupt the PMF and observe effects on SecD-mediated translocation

  • Generate SecD variants with mutations in the transmembrane domains involved in proton translocation

  • Reconstitute purified SecD in proteoliposomes with established proton gradients to measure translocation efficiency

These approaches would help elucidate the specific mechanism by which the PMF energizes SecD function in Magnetococcus sp. and how this might differ from model organisms.

What methodologies are most effective for studying SecD interactions with other Sec translocon components in Magnetococcus sp.?

For studying protein-protein interactions involving SecD:

  • Co-immunoprecipitation: Using anti-SecD antibodies to pull down interaction partners

  • Bacterial two-hybrid assays: For detecting binary interactions

  • Cross-linking coupled with mass spectrometry: To capture transient interactions and identify interaction interfaces

  • Förster resonance energy transfer (FRET): For monitoring interactions in live cells

  • Surface plasmon resonance (SPR): To determine binding kinetics between purified components

When investigating SecD interactions with other Sec components, researchers should consider the altered ratio of SecY and SecE that occurs during recombinant protein production , which may affect the availability of functional Sec translocons. This altered stoichiometry could impact the formation and stability of complexes containing SecD.

How can single-cell techniques be applied to study SecD function in individual Magnetococcus sp. cells?

Single-cell analysis of SecD function can reveal cell-to-cell heterogeneity that population-level studies would miss. This approach is particularly valuable for magnetotactic bacteria, which show pronounced heterogeneity in their physical properties and behaviors . Researchers can employ:

  • Microfluidic trapping: Using devices with actuatable elastomeric PDMS membranes to create defined micrometer-sized containers for observing individual bacteria over extended periods

  • Single-cell fluorescence microscopy: With fluorescently tagged substrates to track translocation events

  • Single-cell RNA-seq: To correlate SecD expression with other cellular processes

  • Super-resolution microscopy: To visualize SecD localization and dynamics at the nanoscale

These approaches allow researchers to account for considerable heterogeneities in bacterial populations and pinpoint main characteristics that would otherwise be lost in population-level analyses .

What research approaches can distinguish between cotranslational and posttranslational roles of SecD in Magnetococcus sp.?

To differentiate between cotranslational and posttranslational functions of SecD:

  • Ribosome profiling: This technique can reveal whether SecD associates with translating ribosomes, similar to how SecA has been shown to bind ribosomes and participate in cotranslational translocation

  • In vitro translation-translocation assays: Using purified components to reconstitute both pathways

  • Pulse-chase experiments: To track the timing of protein association with SecD

  • Signal sequence swapping: Replacing signal sequences that direct proteins to either pathway and observing effects on SecD dependency

Recent research has shown that SecA, previously thought to function primarily in posttranslational translocation, also plays significant roles in cotranslational pathways . Similarly, investigating the dual roles of SecD would provide insights into the integrated nature of these pathways in Magnetococcus sp.

What strategies can overcome the toxicity issues when expressing recombinant Magnetococcus sp. SecD in heterologous hosts?

Expressing membrane proteins like SecD often presents toxicity challenges in heterologous hosts. Effective strategies include:

  • Tightly regulated expression systems: Using promoters with minimal leaky expression

  • Fusion partners: Adding solubility-enhancing tags (MBP, SUMO) that can be later removed

  • Lower growth temperatures: Reducing expression rate by growing at 18-25°C

  • Specialized host strains: Using C41/C43(DE3) or other strains designed for toxic membrane proteins

  • Cell-free expression systems: Bypassing toxicity issues entirely

Research has shown that production of membrane proteins can saturate the Sec translocon capacity, leading to accumulation of precursors of secretory proteins in the cytoplasm and induction of stress responses . Lowering the expression rate of recombinant proteins by reducing the expression intensity can prevent this saturation and increase protein production yields .

How can researchers address the challenges of SecD stability during functional reconstitution experiments?

Maintaining SecD stability during reconstitution requires attention to several factors:

  • Lipid composition: Optimizing the lipid environment to mimic the native Magnetococcus sp. membrane

  • Detergent selection: Testing multiple detergents for their ability to maintain SecD structure and function

  • Reconstitution method: Comparing different methods (direct incorporation, detergent dialysis, or SEC-based methods)

  • Buffer optimization: Including stabilizing agents such as glycerol or specific ions

  • Temperature control: Performing reconstitution at lower temperatures to minimize protein denaturation

When reconstituting SecD into proteoliposomes, researchers should consider including other Sec components, particularly SecF, which forms a complex with SecD and enhances its stability. The reconstituted system should be validated using functional assays that measure protein translocation efficiency or PMF utilization.

How does the magnetic field response of Magnetococcus sp. impact SecD function and protein translocation?

Magnetotactic bacteria like Magnetococcus sp. respond to magnetic fields due to the presence of magnetosomes, which are membrane-bound organelles containing magnetic crystals . This unique characteristic may influence protein translocation processes, including SecD function. Research approaches to investigate this relationship include:

  • Comparative analysis: Studying SecD function in the presence and absence of magnetic fields

  • Mutant studies: Analyzing SecD activity in magnetosome-deficient mutants

  • Translocation assays: Measuring protein export efficiency under various magnetic field strengths and orientations

Since magnetotactic bacteria can be magnetically steered and show various movement patterns depending on confinement and magnetic field strength , researchers can design experiments that correlate these behaviors with SecD-dependent protein export processes.

What computational approaches are most valuable for predicting substrate specificity of Magnetococcus sp. SecD?

Computational methods for analyzing SecD substrate specificity include:

  • Homology modeling: Building structural models of Magnetococcus sp. SecD based on crystal structures from other bacteria

  • Molecular dynamics simulations: Investigating conformational changes during the translocation cycle

  • Machine learning algorithms: Training on known Sec substrates to predict new ones

  • Protein-protein docking: Simulating interactions between SecD and potential substrate proteins

These computational approaches should be validated experimentally, perhaps using techniques similar to those employed to study SecA interactions with substrates . By combining computational predictions with experimental validation, researchers can develop a comprehensive understanding of SecD substrate specificity in Magnetococcus sp.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.