Recombinant Magnetococcus sp. Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Sec System

SecF is a core subunit of the SecDFYajC complex, which partners with SecYEG to mediate post-translational protein translocation across bacterial membranes . Key functional insights include:

  • Mechanistic Role: SecDF stabilizes the SecYEG translocon and enhances substrate binding efficiency. In E. coli, SecDF depletion reduces protein export rates by >50%, particularly under cold stress .

  • Structural Dynamics: Homologs like Thermus thermophilus SecDF adopt two conformations ("F" and "I" forms), which modulate translocon stability during substrate passage . Magnetococcus SecF likely shares analogous conformational flexibility.

  • Link to Magnetosome Biogenesis: While direct evidence is limited, Magnetococcus marinus encodes magnetosome-associated proteins (e.g., MamC, MamF) whose export may depend on SecDFYajC . Recombinant SecF could enable studies on magnetosome membrane protein trafficking.

3.1. Biochemical Studies

  • Heterologous Expression: Recombinant SecF retains functionality in E. coli-based assays, enabling cross-species studies of SecDFYajC interactions .

  • Mutational Analysis: In E. coli, SecF residues critical for zinc binding (e.g., His153, Asp157) are conserved in Magnetococcus SecF, suggesting similar metal-dependent structural roles .

3.2. Industrial and Medical Relevance

  • Antibody Conjugation: Fusion proteins like Staphylococcal protein A (SPA) expressed on magnetosomes require efficient translocation machinery, potentially leveraging SecF for surface display .

  • Translation Arrest Motifs: A 2024 study identified conserved motifs upstream of secDF operons, implicating SecF in regulated ribosome stalling during stress responses .

Comparative Analysis with Homologs

FeatureMagnetococcus SecFE. coli SecFT. thermophilus SecDF
Gene LocusMmc1_3211secF (b0903)TTHA0614 (single-chain)
Transmembrane Helices6 (predicted)612 (fusion of SecD/SecF)
Conserved DomainsP1 (periplasmic head/base)P1, P4 (periplasmic)P1 (F/I conformers)
EssentialityNot determinedNon-essential but criticalEssential for growth

Challenges and Future Directions

  • Structural Resolution: No crystal structure exists for Magnetococcus SecF. Homology modeling using T. thermophilus templates could clarify its role in magnetotaxis .

  • Functional Redundancy: Mycobacterial studies show paralogs (e.g., SecA1/SecA2) compensate for export defects , but Magnetococcus SecF redundancy remains unexplored.

  • Biotechnological Optimization: Enhancing SecF expression in E. coli could improve yields for industrial-scale applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
secF; Mmc1_3211; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Target Names
secF
Target Protein Sequence
MQVFLKATHFDFIGRRKPAIYASLFLIGVSLVSLFTQGLNFGIDFAGGTLIQVRFEKPMD LAPVRQAIAPLDLGDTVVQSFGTPEEVLIRVEKQGADNAAQQAIVSGVLDALKPIAGEHG VEMRRVEYVGPQVGEELTEKGMLAMLYAMVAILIYISFRFELRFALGAVLALVHDVVLTM GFFSVLQKEFTLVVVAALLTVVGYSLNDTIVVYDRIREEMKRMKRQPLATIINEAVNRTL SRTLITSLTTVLVLIALFVLGGAVIHDFALTLLFGVGIGTYSSIFVASPLVLLMDPGSRR KVAAETAEETP
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of SecF in bacterial protein translocation?

SecF is an integral component of the bacterial preprotein translocase holoenzyme that includes SecY, SecE, SecG, SecD, SecF, and YajC subunits. While the SecYE complex forms the core translocation channel and is sufficient to activate SecA as a preprotein-dependent ATPase, the SecDFyajC complex (which includes SecF) plays a critical stimulatory role in protein translocation efficiency. The SecDFyajC complex specifically facilitates and stabilizes SecA membrane insertion during translocation .

The stimulatory activity of SecDFyajC becomes particularly evident when SecG is either absent or present at subsaturating concentrations with respect to SecYE, indicating complementary roles between these components . In Magnetococcus sp., SecF likely performs analogous functions in supporting efficient protein translocation across the cytoplasmic membrane.

Is SecF essential for bacterial viability?

For Magnetococcus sp. specifically, the essentiality of SecF would need to be determined experimentally, as the requirement for SecF can vary between bacterial species and growth conditions.

How does SecF structurally integrate into the Sec translocase complex?

SecF forms part of the SecDFyajC subcomplex that associates with the core SecYE translocon to create the holoenzyme form of preprotein translocase. Functional studies using systematically depleted or overproduced subunits reveal that this integration is physical and functional . The SecDFyajC complex appears to be primarily involved in modulating the SecA insertion/de-insertion cycle rather than directly forming the protein-conducting channel.

How does the SecDFyajC complex modulate the SecA insertion/de-insertion cycle?

The SecDFyajC complex exerts a dual effect on the SecA cycle that is distinct from the effects of SecG. Specifically, SecDFyajC:

  • Prevents the de-insertion of SecA (which requires ATP hydrolysis)

  • Increases the initial insertion of SecA (which involves only nucleotide binding)

This regulatory function may increase translocation efficiency of normal preproteins (as observed in the absence of SecG) and facilitate translocation of preproteins with defective leader peptides . The timing of SecDFyajC action also differs from SecG, as SecDFyajC appears to influence both early and later stages of the translocation process.

What is the relationship between SecF function and the proton motive force (PMF)?

The function of the Sec translocase system is intimately connected with the proton motive force (PMF). Recent research reveals that SecA works in coordination with the PMF during cotranslational protein translocation, particularly when resolving large periplasmic loops of inner membrane proteins .

While the search results don't explicitly detail how PMF affects SecF specifically in Magnetococcus sp., experimental evidence from other bacterial systems suggests that SecDF utilizes the PMF to enhance protein translocation. This relationship could be investigated by assessing protein translocation efficiency in Magnetococcus sp. under conditions where the PMF is dissipated compared to normal conditions.

How does SecF contribute to the translocation of different protein substrates?

The SecDFyajC complex appears to have differential effects on various protein substrates. Research has demonstrated that this complex can facilitate the translocation of preproteins with defective leader peptides . Additionally, SecA (which functions in concert with the SecYEG-SecDF machinery) recognizes and resolves large periplasmic loops of inner membrane proteins during their cotranslational translocation and associates with secretory proteins that have highly hydrophobic signal sequences .

For Magnetococcus sp., it would be particularly interesting to investigate whether SecF has evolved specialized functions related to the translocation of magnetosome membrane proteins, given the importance of these structures in magnetotactic bacteria.

What expression systems are most effective for producing recombinant Sec proteins?

Based on the available research data, E. coli expression systems using fusion proteins have proven effective for recombinant protein production, including membrane proteins. A comparative analysis of different N-terminal tags revealed that:

Fusion TagRelative FluorescenceSolubilityInclusion Body Formation
CusFHighestHighLow
MBPLower than CusFHighModerate
GSTLower than CusFModerateModerate

The CusF fusion system demonstrated superior performance with higher fluorescence intensity (when tested with GFP) and produced large amounts of soluble protein with low levels of inclusion bodies . This approach could potentially be adapted for SecF from Magnetococcus sp.

How can I assess the functionality of recombinant Magnetococcus sp. SecF in vitro?

To evaluate SecF functionality, you can adapt the established in vitro translocation assay described in the literature. This involves:

  • Preparing inverted membrane vesicles (IMVs) from strains with depleted or deleted endogenous SecF

  • Reconstituting these IMVs with purified recombinant Magnetococcus sp. SecF

  • Conducting translocation reactions using 35S-labeled proOmpA (a model secretory preprotein), SecB, SecA, and ATP

  • Measuring translocation efficiency by quantifying protected (translocated) labeled protein

To isolate the ATP-driven component of translocation from PMF-driven translocation, IMVs can be made proton-permeable by removing the F1 subunit of the F1F0-ATPase . The translocation efficiency with recombinant SecF can then be compared against appropriate controls (e.g., vesicles lacking SecF or containing wild-type SecF).

What are the optimal conditions for purifying recombinant Magnetococcus sp. SecF?

For membrane proteins like SecF, purification typically requires careful optimization of detergent solubilization and chromatography conditions. Based on successful approaches with other recombinant membrane proteins, a recommended purification protocol would include:

  • Expression with an affinity tag (such as His6 or fusion with CusF)

  • Membrane isolation and solubilization using mild detergents (e.g., DDM, LDAO)

  • Initial purification via affinity chromatography (if using CusF fusion, copper ion-charged IMAC resins are effective)

  • Additional purification steps such as ion exchange or size exclusion chromatography

  • Optional reconstitution into proteoliposomes or nanodiscs to maintain native-like environment

The optimal detergent and buffer conditions would need to be determined empirically for Magnetococcus sp. SecF specifically.

How might SecF function relate to magnetosome formation in Magnetococcus sp.?

Magnetosomes are membrane-enclosed magnetite nanocrystals synthesized by magnetotactic bacteria, with specific transmembrane proteins sorted to the magnetosome membrane (MM) . While the search results don't directly address the role of SecF in magnetosome formation, the Sec translocase system might be involved in translocating proteins destined for the magnetosome membrane.

Research on Magnetospirillum gryphiswaldense has identified MamC as the most abundant MM protein and MamF as the second most abundant MM protein that forms stable oligomers . Investigating whether these or other magnetosome-specific proteins are SecF-dependent substrates would provide valuable insights into the potential role of SecF in magnetosome biogenesis in Magnetococcus sp.

Can SecF mutations affect magnetosome membrane protein integration?

This question has not been directly addressed in the available research, but represents an important avenue for investigation. Based on our understanding of SecF function in protein translocation, mutations in SecF might potentially affect the integration of certain magnetosome membrane proteins.

A methodological approach to investigate this would include:

  • Generating SecF mutants in Magnetococcus sp. (point mutations or deletion)

  • Analyzing the composition of isolated magnetosome membranes by proteomics

  • Assessing magnetosome formation and function in these mutants

  • Conducting complementation experiments with wild-type or mutant SecF variants

Such studies would shed light on whether SecF plays a specific role in magnetosome biogenesis beyond its general function in protein translocation.

What are the common challenges in working with recombinant SecF and how can they be addressed?

Working with membrane proteins like SecF presents several technical challenges:

ChallengeSolution Strategy
Low expression levelsOptimize codon usage, use strong promoters, consider expression hosts specialized for membrane proteins
Protein misfoldingLower induction temperature, use specialized E. coli strains (e.g., C41/C43), co-express with chaperones
Aggregation during purificationOptimize detergent type and concentration, include stabilizing additives (glycerol, specific lipids)
Loss of function during purificationMaintain native-like lipid environment, use mild solubilization conditions, reconstitute into liposomes

For Magnetococcus sp. SecF specifically, adaptation to the unique physiological characteristics of this magnetotactic bacterium might require additional considerations, such as the potential importance of specific lipids or cofactors.

How can I detect interactions between SecF and other components of the Sec system?

To investigate the interactions between Magnetococcus sp. SecF and other Sec components, several complementary approaches can be employed:

  • Co-immunoprecipitation using antibodies against SecF or its potential interaction partners

  • Pull-down assays with tagged recombinant SecF

  • Chemical cross-linking followed by mass spectrometry to identify interaction partners

  • Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) to detect interactions in live cells

  • Bacterial two-hybrid systems to screen for protein-protein interactions

These methods could reveal whether Magnetococcus sp. SecF has unique interaction patterns compared to SecF proteins from other bacteria, potentially reflecting adaptations to its magnetotactic lifestyle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.