Recombinant Magnetococcus sp. Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Magnetococcus sp. Sec-Independent Protein Translocase Protein TatC (tatC)

Recombinant Magnetococcus sp. Sec-independent protein translocase protein TatC (tatC) is a genetically engineered form of the TatC component of the Twin-arginine translocation (Tat) system, expressed in Escherichia coli for research and industrial applications . This protein facilitates the transport of fully folded proteins across bacterial cytoplasmic membranes, a unique capability distinct from the Sec-dependent secretion pathway . The recombinant variant (UniProt ID: A0L833) includes a full-length sequence (1-271 amino acids) fused to an N-terminal His tag, enabling purification and experimental tracking .

Functional Role in the Tat Pathway

The Tat system transports folded proteins requiring cofactors or oligomerization. TatC operates synergistically with TatB:

  1. Substrate recognition: TatC directly binds twin-arginine signal peptides via its transmembrane cavity, while TatB stabilizes interactions .

  2. Complex assembly: TatBC forms oligomeric receptor complexes (e.g., TC1, TC2) that recruit TatA for membrane translocation .

  3. Energy transduction: Proton motive force drives TatA polymerization, enabling substrate transport .

Key functional studies in E. coli demonstrate that mutations in TatC’s N-terminus (e.g., L9F) disrupt signal peptide binding, highlighting its role in substrate specificity .

Research Applications of Recombinant Magnetococcus sp. TatC

The recombinant protein is utilized in:

  • Mechanistic studies: Investigating TatC’s role in signal peptide recognition and translocase assembly .

  • Biotechnology: Engineering bacterial secretion systems for industrial enzyme production .

  • Drug discovery: Targeting TatC to disrupt pathogen protein secretion (e.g., Pseudomonas aeruginosa) .

Comparative Analysis of TatC Across Species

FeatureMagnetococcus sp. TatC Escherichia coli TatC
Amino Acid Length271258
Transmembrane Helices6 (predicted)6 (experimentally confirmed)
Conserved GlutamateLikely present (homology)Glu170 (critical for function)
Recombinant UseProtein interaction studiesMechanistic and structural studies

Future Directions

While Magnetococcus sp. TatC’s recombinant form enables structural and functional studies, further research is needed to:

  • Resolve its high-resolution structure via cryo-EM or crystallography.

  • Characterize its interaction with TatA/B homologs in vitro.

  • Explore biotechnological applications in synthetic biology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your reconstitution.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is defined during production. If you have a specific tag requirement, please inform us, and we will prioritize development based on your specification.
Synonyms
tatC; Mmc1_1617; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Target Names
tatC
Target Protein Sequence
MNLDVEQKAPLVEHLIELRNRLMISVGAIIVGFILCYSFSEQIFEFLAAPLHEILGPQAK MIYTALHEAFFTQIKVSFFAGLFLAMPVLFTQMWLFIAPGLYQHERSAILPFLFVTPVLF FMGGTLAYYFVFPLAFKFFLGFQSSTIEALPSMREYLSLVIKLIIAFGITFELPVGLLLA IKAGVVSTAGLVDKRKYNIVLAFVAAAILTPPDPFTQVMLAIPIMLMYEISIFFGRGIER KRAEQEAAEEAQWAADHNVDDDDVDHPEHKA
Uniprot No.

Target Background

Function
This protein is a component of the twin-arginine translocation (Tat) system, which facilitates the transport of large, folded proteins containing a characteristic twin-arginine motif in their signal peptide across cellular membranes. In conjunction with TatB, TatC forms a receptor that directly interacts with Tat signal peptides.
Database Links
Protein Families
TatC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and function of TatC in Magnetococcus sp.?

TatC is the largest and most conserved component of the Tat pathway, functioning as the primary binding site for substrate proteins during translocation. It possesses six transmembrane helices with both N-terminus and C-terminus facing the cytoplasmic side (N-in, C-in topology) . Structurally, TatC resembles a baseball glove or cupped hand, as revealed through crystallization studies of homologous proteins like those from Aquifex aeolicus . This configuration creates a binding pocket that accommodates the twin-arginine signal peptides of substrate proteins.

The protein shows restricted structural flexibility, suggesting it undergoes minimal conformational changes during the translocation process . TatC's primary function involves the initial recognition and binding of the signal peptide from Tat substrates, which typically contain a conserved twin-arginine motif. This interaction forms the foundation for subsequent recruitment of other Tat components necessary for translocation.

How does the experimental design approach differ when studying TatC compared to Sec-dependent proteins?

When studying TatC and the Tat pathway, experimental designs must account for the pathway's unique ability to translocate fully folded proteins, unlike the Sec pathway that transports unfolded proteins. This fundamental difference necessitates specific experimental considerations:

Experimental ConsiderationTat/TatC ApproachSec Pathway Approach
Protein folding stateMust preserve tertiary structure during isolationCan work with denatured proteins
Translocation assaysRequires confirmation of folded state pre/post-translocationPrimarily measures transport efficiency
Signal sequence analysisFocus on twin-arginine motif and surrounding contextFocus on hydrophobic core and cleavage sites
Interaction studiesEmphasizes TatBC complex formation and substrate interactionsExamines SecYEG channel interactions

The design of TatC experiments should incorporate pre-post measurement approaches to assess both the initial state and the outcome of translocation experiments . For effective comparative studies, researchers should employ randomized group designs to compare wild-type and mutant TatC variants, or to compare TatC function across different species like Magnetococcus sp. versus model organisms .

What methodologies are used to purify recombinant Magnetococcus sp. TatC for structural studies?

Purification of recombinant TatC presents unique challenges due to its membrane-embedded nature. A methodological approach typically involves:

  • Expression system optimization: Using specialized bacterial strains (typically E. coli C41(DE3) or C43(DE3)) designed for membrane protein expression, with temperature reduction to 18-20°C after induction to improve proper folding.

  • Membrane extraction: Isolating bacterial membranes through differential centrifugation, followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that maintain protein structure and function.

  • Affinity chromatography: Utilizing histidine-tagged constructs for initial purification via nickel or cobalt affinity chromatography, with detergent present throughout to maintain solubility.

  • Size exclusion chromatography: Further purification and assessment of oligomeric state using gel filtration, which separates TatC complexes from aggregates and other proteins.

  • Quality assessment: Confirmation of proper folding through circular dichroism spectroscopy and functional binding assays with signal peptides.

For structural studies specifically, researchers must evaluate detergent choice carefully, as this significantly impacts crystallization success or the quality of samples for cryo-electron microscopy. The methodological workflow must prioritize maintaining the native conformation of TatC throughout the purification process.

How should researchers interpret contradictory data regarding TatC-substrate interactions?

When confronted with contradictory data regarding TatC-substrate interactions, researchers should implement a systematic analysis approach:

  • Thoroughly examine methodological differences: Contradictions often arise from variations in experimental conditions, such as detergent types, buffer compositions, or the specific constructs used . Create a comprehensive comparison table of all experimental parameters across studies to identify critical variables.

  • Analyze substrate preparation: The folding state of substrates can significantly impact their interaction with TatC. Verify whether substrates were properly folded in all studies by examining the methodologies used to confirm protein structure .

  • Consider organism-specific variations: TatC from Magnetococcus sp. may exhibit different binding characteristics compared to homologs from E. coli or B. subtilis. These differences could explain apparently contradictory results when comparing across species .

  • Evaluate detection methods: Cross-linking studies, co-immunoprecipitation, and direct binding assays each have distinct limitations and may capture different aspects of TatC-substrate interactions . The sensitivity and specificity of these methods should be critically assessed.

  • Implement refined variables and additional controls: When designing follow-up experiments, include controls that specifically address the contradictory points and refine the experimental variables to directly test competing hypotheses .

The seemingly contradictory data may actually reveal mechanistic nuances of TatC function rather than experimental errors. For example, reports of varying binding sites on TatC may indicate the presence of multiple interaction modes or sequential binding events during the translocation process .

What experimental design would best characterize the stoichiometry of TatC in functioning translocation complexes?

Characterizing the stoichiometry of functional TatC complexes requires a multi-technique approach that accounts for both static composition and dynamic assembly. An optimal experimental design would include:

TechniqueApplicationExpected OutcomeLimitations
Cross-linking coupled with mass spectrometryCapture in vivo complexesIdentification of interacting subunits and their relative positionsMay capture transient interactions
Blue native PAGEAnalysis of intact complexesSize determination of native complexesLimited resolution of subunit composition
Single-molecule fluorescenceReal-time assembly monitoringDynamic stoichiometry changes during translocationTechnical complexity and low throughput
Cryo-electron microscopyStructural analysisHigh-resolution structure of assembled complexesRequires stable, homogeneous samples

The experimental design should follow a Solomon Four Group approach to control for pre-measurement effects . This would involve:

  • Random assignment of bacterial cultures expressing TatC to different conditions

  • Pre-measurement of baseline complex formation in some groups

  • Application of substrate or other treatments to induce complex assembly

  • Post-measurement of complex formation across all groups

Current evidence suggests TatC interacts with TatB in a 1:1 stoichiometry, with multiple TatBC units assembling into larger complexes. Low-resolution electron microscopy structures have revealed a hemispherical morphology with an internal cavity that could accommodate signal peptides, with approximately seven copies of TatBC fitting into the 11- to 17-nm reconstruction . This experimental design would verify and extend these findings specifically for Magnetococcus sp. TatC.

How do researchers address the challenges of analyzing TatC signal peptide binding when data contradicts theoretical predictions?

When experimental data on TatC-signal peptide interactions contradicts theoretical predictions, researchers should implement a systematic troubleshooting approach:

  • Examine the data thoroughly: Carefully analyze raw data to identify potential outliers or patterns that might explain the discrepancy. Create visual representations of the data to facilitate pattern recognition .

  • Re-evaluate theoretical models: The theoretical predictions may be based on incomplete understanding or oversimplified models. Consider whether the model accounts for species-specific variations in Magnetococcus sp. TatC compared to more studied homologs .

  • Consider alternative binding modes: Current evidence indicates that signal peptides insert deeply into TatC by adopting a hairpin-like conformation . If experimental data contradicts this model, explore whether alternative binding configurations might exist under specific conditions.

  • Implement refined experimental approaches:

    • Utilize site-specific cross-linking with photo-activatable amino acids at predicted interaction sites

    • Employ hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Develop fluorescence-based assays to measure binding kinetics under varying conditions

  • Combine structural and functional analyses: Integrate data from structural studies (e.g., NMR or X-ray crystallography) with functional assays that measure translocation efficiency to establish structure-function relationships .

Contradictory data often emerges when examining complex interaction networks like those in the Tat pathway. For example, initial binding of signal peptides to TatC may trigger conformational changes that expose secondary binding sites, which would not be predicted by static structural models. By systematically investigating these possibilities, researchers can reconcile contradictory findings and develop more comprehensive models of TatC function.

What methodological approaches can be used to study the dynamics of TatC during the translocation process?

Understanding the dynamics of TatC during translocation requires methodologies that can capture both structural changes and temporal progression. An integrated methodological approach should include:

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy: This technique can measure distances between specific residues and detect conformational changes during substrate binding and translocation. Multiple spin labels can be introduced at strategic positions in TatC to create a dynamic map of protein movement.

  • Single-molecule Förster resonance energy transfer (smFRET): By labeling TatC with donor and acceptor fluorophores at specific positions, researchers can monitor distance changes between domains in real-time during the translocation process. This approach can reveal transient intermediates that may be missed by ensemble methods.

  • Time-resolved cryo-electron microscopy: Capturing the translocation process at different time points after substrate addition can provide structural snapshots of TatC during sequential stages of translocation.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of TatC that undergo changes in solvent accessibility during substrate binding and translocation, indicating conformational rearrangements.

  • Molecular dynamics simulations: Computational approaches can model the dynamic behavior of TatC within a membrane environment over microsecond to millisecond timescales, generating testable hypotheses about conformational changes.

These methodologies should be implemented within a pre-post randomized group experimental design to ensure rigorous controls and statistical validation . Current evidence suggests TatC shows restricted structural flexibility and is unlikely to undergo major conformational changes during translocation , but more dynamic aspects may be revealed through these sensitive techniques.

How can researchers optimize expression of recombinant Magnetococcus sp. TatC to improve yield and functionality?

Optimization of recombinant TatC expression requires attention to multiple factors that influence membrane protein production. A systematic optimization strategy includes:

  • Expression vector selection: Vectors with tunable promoters (such as pBAD or pRha) allow fine control of expression levels, preventing toxic accumulation of membrane proteins. Lower expression rates often improve proper membrane insertion and folding of TatC.

  • Host strain engineering:

    • Use specialized strains like C41(DE3), C43(DE3), or Lemo21(DE3) designed for membrane protein expression

    • Consider Magnetococcus-specific codon optimization when expressing in E. coli

    • Evaluate co-expression with chaperones like DnaK/DnaJ/GrpE to improve folding

  • Growth condition optimization:

ParameterOptimization StrategyImpact on TatC Expression
TemperatureReduce to 18-20°C after inductionSlows protein synthesis, improves folding
Inducer concentrationUse gradient testing to find optimal concentrationBalances expression level with toxicity
Media compositionSupplement with glycerol and specific ionsSupports membrane biogenesis
Growth phaseInduce at mid-log phase (OD600 0.6-0.8)Ensures cells are metabolically active
  • Fusion tag strategies: N-terminal fusions can improve expression while C-terminal tags may impact function less. Consider testing:

    • Maltose-binding protein (MBP) fusions to improve solubility

    • Green fluorescent protein (GFP) fusions to monitor expression and folding

    • Twin-Strep or His8 tags for efficient purification

  • Functional validation: Develop activity assays to confirm that the expressed TatC properly functions in substrate binding. This could involve measuring interaction with twin-arginine signal peptides using in vitro binding assays.

When troubleshooting expression problems, systematically analyze each step in the expression workflow, keeping detailed records of all parameters. Design experiments with appropriate controls, including expression of well-characterized membrane proteins under identical conditions to distinguish TatC-specific issues from general expression problems.

What strategies should be employed when experimental data suggests unexpected oligomeric states of TatC?

When experimental data indicates unexpected oligomeric states of TatC that contradict the literature, researchers should implement a systematic investigation approach:

  • Verify sample integrity: First, confirm that the unexpected results aren't due to protein aggregation or degradation:

    • Analyze samples using SDS-PAGE and western blotting to check for degradation products

    • Perform size exclusion chromatography to distinguish between specific oligomers and non-specific aggregates

    • Use negative stain electron microscopy to visually inspect particle homogeneity

  • Evaluate experimental conditions: Different detergents, lipids, and buffer compositions can significantly affect the oligomeric state of membrane proteins:

    • Test multiple detergents with varying micelle sizes and properties

    • Reconstitute TatC into nanodiscs or liposomes to provide a more native-like membrane environment

    • Systematically vary salt concentration, pH, and temperature to identify condition-dependent oligomerization

  • Apply multiple complementary techniques:

TechniqueInformation ProvidedLimitations to Consider
Analytical ultracentrifugationPrecise molecular weight in solutionDetergent contribution must be accounted for
Native mass spectrometryAccurate mass of intact complexesRequires specialized instrument settings for membrane proteins
Multi-angle light scatteringAbsolute molecular weight independent of shapeComplex interpretation for membrane proteins
Cross-linking coupled with mass spectrometryIdentification of interaction interfacesMay stabilize transient interactions
  • Consider biological context: Investigate whether the observed oligomeric state might have functional relevance:

    • Compare oligomerization in the presence and absence of substrate proteins

    • Assess oligomerization when co-expressed with other Tat components

    • Create site-directed mutants at potential oligomerization interfaces to test their importance

  • Address discrepancies systematically: If results still contradict published data, design experiments that directly test conditions from previous studies alongside your own conditions . Consider species-specific differences, as Magnetococcus sp. TatC may behave differently than E. coli or other model organisms.

Current evidence suggests TatB and TatC interact in a 1:1 stoichiometry, and several TatBC complexes bind substrates . If experimental data contradicts this model, it may reveal novel features of Magnetococcus sp. TatC or identify previously unrecognized assembly intermediates.

How can researchers troubleshoot when TatC mutants show unexpected phenotypes in translocation assays?

When TatC mutants display unexpected phenotypes in translocation assays, researchers should implement a systematic troubleshooting strategy:

  • Verify mutant construction:

    • Sequence the entire tatC gene to confirm the intended mutation and absence of secondary mutations

    • Check expression levels of the mutant protein to ensure phenotypes aren't due to altered protein abundance

    • Verify membrane localization of the mutant TatC using fractionation and western blotting

  • Analyze the nature of the unexpected phenotype:

    • Determine if the phenotype reflects a complete loss of function or altered activity

    • Assess whether the phenotype is substrate-specific or affects all Tat substrates

    • Examine whether the phenotype is conditional (temperature-sensitive, pH-dependent, etc.)

  • Investigate structure-function relationships:

    • Map the mutation onto available structural models of TatC to understand its potential impact

    • Consider whether the mutation might affect known functional regions like the substrate binding pocket or TatB interaction sites

    • Create a series of conservative mutations at the same position to establish structure-function correlations

  • Examine interactions with pathway components:

    • Test binding of twin-arginine signal peptides to the mutant TatC

    • Assess interaction with TatB using co-immunoprecipitation or cross-linking

    • Evaluate assembly into higher-order Tat complexes using blue native PAGE

  • Consider indirect effects:

    • Examine membrane integrity in strains expressing the mutant TatC

    • Assess potential polar effects on expression of other tat genes

    • Test for compensatory mutations that might arise during growth

When interpreting contradictory data, remember that conserved Glu residues (like Glu165 in A. aeolicus or Glu170 in E. coli) near the signal peptide binding pocket are known to be functionally important . Mutations affecting these residues might produce especially complex phenotypes due to their roles in substrate recognition and membrane interactions.

What methodological approaches would be most effective for studying species-specific differences between Magnetococcus sp. TatC and other bacterial homologs?

Investigating species-specific differences in TatC requires a comprehensive comparative approach that integrates multiple levels of analysis:

  • Comparative sequence and structural analysis:

    • Conduct comprehensive multiple sequence alignments of TatC proteins across diverse bacterial species

    • Perform evolutionary rate analysis to identify rapidly evolving versus conserved regions

    • Use homology modeling based on available crystal structures to predict structural differences

    • Apply molecular dynamics simulations to compare dynamic properties in different species

  • Heterologous expression and complementation:

    • Express Magnetococcus sp. TatC in model organisms with tatC deletions (e.g., E. coli ΔtatC)

    • Test functional complementation across species boundaries using standardized translocation assays

    • Create chimeric proteins combining domains from different species to map functional differences

  • Comparative biochemical characterization:

PropertyMethodologyExpected Insights
Substrate specificityIn vitro binding assays with diverse signal peptidesDifferences in recognition elements
Complex assemblyBlue native PAGE and co-immunoprecipitationSpecies-specific interaction partners
Lipid interactionsLipidomics and reconstitution in defined lipid environmentsMembrane environment preferences
Translocation kineticsReal-time translocation assaysEfficiency and rate differences
  • System-level analysis:

    • Compare the entire Tat pathway composition across species

    • Analyze co-evolution patterns between TatC and other Tat components

    • Investigate environmental adaptations that might drive TatC evolution in Magnetococcus

This research should employ a pre-post randomized group experimental design to ensure rigorous comparisons between species . Current evidence suggests TatC shows conserved structural features across species, resembling a baseball glove or cupped hand , but species-specific adaptations likely exist to accommodate different substrate repertoires and environmental conditions.

How might contradictory findings about TatC function lead to novel insights about the Tat pathway?

Contradictory findings in TatC research can serve as valuable catalysts for deeper mechanistic understanding. When properly analyzed, these apparent inconsistencies often reveal underlying complexity in the Tat system:

  • Reframing contradictions as context-dependent mechanisms:

    • Seemingly contradictory binding modes may represent different stages in a multi-step translocation process

    • Divergent findings across species might reveal evolutionary adaptations to specific cellular environments

    • Inconsistent oligomeric states could reflect dynamic assembly/disassembly during the transport cycle

  • Designing targeted experiments to resolve contradictions:

    • Create experimental conditions that systematically vary between contradictory studies to identify critical factors

    • Develop real-time assays that can capture transitions between different states or binding modes

    • Implement genetic approaches to isolate translocation intermediates that might explain contradictory observations

  • Utilizing contradictions to generate new hypotheses:

    • Propose integrative models that incorporate apparently contradictory findings into a coherent mechanism

    • Identify previously overlooked regulatory factors that might reconcile contradictory observations

    • Develop mathematical models that predict condition-dependent switching between different operational modes

  • Applying emerging technologies to resolve contradictions:

    • Use cryo-electron tomography to visualize Tat complexes in their native membrane environment

    • Apply single-molecule tracking to follow individual translocation events in real-time

    • Implement proteome-wide approaches to identify the complete substrate repertoire and regulatory networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.