Recombinant Magnetospirillum magneticum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

atpB (UniProt ID: Q2W028) encodes subunit a of the F-type ATP synthase in M. magneticum AMB-1. Key features include:

PropertyDetail
Protein Length247 amino acids (full-length)
Structural RoleIntegral membrane component of the F₀ sector, enabling proton translocation
DomainsContains transmembrane helices critical for proton channel formation
Expression SystemEscherichia coli with N-terminal His tag
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Role in ATP Synthase

Subunit a is essential for the rotary mechanism of ATP synthase:

  • Forms part of the F₀ proton channel, coupling proton motive force to ATP synthesis in the F₁ sector .

  • Interacts with subunit c (atpE) to create a helical interface for proton translocation .

  • Critical for maintaining membrane potential in M. magneticum, which relies on redox gradients for magnetosome biogenesis .

Production and Purification

Recombinant atpB is produced via heterologous expression:

  1. Cloning: Full-length atpB (amb3993 locus) is inserted into an E. coli expression vector .

  2. Expression: Induced under optimized conditions; insoluble inclusion bodies are common due to transmembrane domains .

  3. Purification: Affinity chromatography using His-tag, followed by refolding and lyophilization .

Key Challenges:

  • Low solubility necessitates detergent-based solubilization .

  • Structural instability during storage requires glycerol or trehalose additives .

Research Applications

This recombinant protein is used to:

  • Study proton translocation mechanisms in ATP synthases .

  • Investigate evolutionary adaptations of bioenergetic systems in magnetotactic bacteria .

  • Serve as a antigen for antibody development in microbial physiology studies .

Comparative Analysis of Related Subunits

SubunitGeneLength (aa)FunctionSource
atpBamb3993247F₀ proton channel assembly M. magneticum
atpFamb3994178Stabilizes F₀-F₁ interaction M. magneticum
atpEamb399574Proton-binding rotor subunit M. magneticum

Key Research Insights

  • Biochemical Stability: Lyophilized atpB retains activity for ≥6 months at -80°C but degrades after 3 freeze-thaw cycles .

  • Structural Homology: Shares 62% sequence identity with E. coli ATP synthase subunit a, highlighting conserved proton channel motifs .

  • Functional Studies: CRISPRi knockdown of atpB in M. magneticum disrupts magnetosome alignment, linking bioenergetics to biomineralization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; amb3993; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Target Names
atpB
Target Protein Sequence
MANPIEQFKIQPLVPLKVGSVDISFTNSSAMMVLSICLITLFLTLSVRSRALVPGRWQSM AEVFYEFIAGMLRDNVGQEGRKYFPFIFSLFMFVLFGNLLGMMPIPVIGFTYTSHVIVTF AMALVVFVGVTVIGFARHGTHYLRMFFPHGAPIATAVILIPIELISYFSRPFSLAVRLFA NMTVGHIILKVMGGFVVSLGAFYLIPGAVPFAFLSAITVLEFGIALLQAYVFTILSCIYL HDAIHMH
Uniprot No.

Target Background

Function

Function: Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Database Links

KEGG: mag:amb3993

STRING: 342108.amb3993

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the relationship between ATP synthase and magnetosome formation in Magnetospirillum magneticum?

ATP synthase plays a crucial role in energy production in M. magneticum, which directly impacts magnetosome formation. Research indicates that magnetosome biosynthesis is an energy-dependent process, with ATP synthase genes being regulated by the global regulator Crp (cAMP receptor protein). When the crp gene is disrupted in magnetotactic bacteria, both energy metabolism and magnetosome formation are significantly impaired . Specifically, RNA-seq and qRT-PCR analyses have shown that many genes related to energy metabolism, including F-type ATPase synthesis genes, are regulated by Crp in these bacteria . This regulatory relationship highlights the importance of ATP synthase in providing the energy required for the complex process of magnetosome biomineralization.

How can I verify the functionality of recombinant M. magneticum atpB protein?

Verifying the functionality of recombinant atpB requires multiple approaches:

  • ATP hydrolysis assay: Measure ATP hydrolysis activity using a coupled enzyme assay with phosphoenolpyruvate, pyruvate kinase, and lactate dehydrogenase, tracking NADH oxidation at 340 nm.

  • Proton translocation measurements: Assess proton pumping activity using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) in reconstituted liposomes.

  • Complementation studies: Transform the recombinant atpB gene into an atpB-deficient strain of M. magneticum or M. gryphiswaldense to assess whether it restores ATP synthesis and magnetosome formation. Similar complementation approaches have been successful with other magnetosome-associated proteins .

  • Protein-protein interaction assays: Use pull-down assays or bacterial two-hybrid systems to verify interactions with other ATP synthase subunits, which would confirm proper folding and functionality.

What purification strategy should I use for recombinant M. magneticum atpB?

For membrane proteins like atpB, a multi-step purification strategy is recommended:

Purification StepBuffer CompositionPurpose
Membrane isolation50 mM Tris-HCl pH 8.0, 150 mM NaClSeparate membrane fraction
SolubilizationAbove buffer + 1-2% detergent (DDM, LDAO, or C12E8)Extract protein from membrane
IMACAbove buffer + 0.05% detergent, 20-500 mM imidazole gradientCapture His-tagged protein
Size exclusion25 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl₂, 0.02% detergentRemove aggregates, exchange detergent

The choice of detergent is critical for maintaining protein stability and activity. n-Dodecyl β-D-maltoside (DDM) has proven effective for many membrane proteins, including components of the ATP synthase complex. For structural studies, the protein can be reconstituted into nanodiscs or amphipols to better mimic the native membrane environment.

How does the redox state of the cell influence atpB function in M. magneticum, and how can this be experimentally assessed?

The function of atpB in M. magneticum is likely influenced by the redox state of the cell, particularly given the bacterium's unique iron metabolism related to magnetosome formation. Studies on M. magneticum have shown that c-type cytochromes like MamP and MamT, which are involved in redox chemistry, are essential for magnetosome formation . The redox-dependent function of atpB can be assessed through:

  • Redox potential manipulation: Culture bacteria under different oxygen tensions or with redox-active compounds to alter cellular redox state, then evaluate ATP synthesis rates and magnetosome formation.

  • Site-directed mutagenesis: Identify and mutate residues in atpB potentially involved in redox sensing, then assess the impact on function.

  • Redox-sensitive probes: Use fluorescent redox sensors fused to atpB or expressed nearby to monitor local redox environments during ATP synthesis.

  • Electron paramagnetic resonance (EPR) spectroscopy: Analyze the redox state of iron centers that might interact with or influence atpB function.

Recent findings indicate that the Fe(III)-Fe(II) redox couple in magnetotactic bacteria operates at unusual potentials (-89 ± 11 mV for MamP) , suggesting that ATP synthesis might be adapted to function optimally within this specialized redox environment.

What structural and functional differences exist between atpB from M. magneticum and other well-characterized bacterial ATP synthases?

While specific structural information about M. magneticum atpB is limited, comparative sequence analysis suggests several noteworthy differences:

FeatureTypical Bacterial atpBM. magneticum atpBFunctional Implication
Transmembrane helices5-6 helicesPredicted 5 helices with unique residue compositionPotentially adapted for unique membrane environment of magnetosome
Proton channel residuesConserved acidic residues (Asp, Glu)Some substitutions in key positionsMay alter proton translocation efficiency or pH optimum
C-terminal domainVariable across speciesContains unique motifsPossible specialized interactions with magnetosome proteins

These differences likely reflect adaptations to the unique bioenergetic requirements of magnetosome formation. To experimentally investigate these differences, researchers should consider:

  • Conducting homology modeling based on known ATP synthase structures

  • Performing targeted mutagenesis of unique residues to assess their functional significance

  • Using chimeric constructs between M. magneticum atpB and well-characterized homologs to identify domains responsible for specialized functions

How can I establish a reliable in vitro system to study the integration of M. magneticum atpB into magnetosome membranes?

Establishing an in vitro system for studying atpB integration into magnetosome membranes requires:

  • Isolation of magnetosome membranes: Extract intact magnetosomes from M. magneticum using magnetic separation followed by gradient ultracentrifugation to purify the magnetosome membranes.

  • Fluorescently labeled atpB: Express recombinant atpB fused to a fluorescent protein (e.g., GFP) or labeled with a fluorescent dye that doesn't interfere with function.

  • Reconstitution assay: Combine purified atpB with isolated magnetosome membranes under various conditions (pH, ion concentration, redox state) and monitor insertion using:

    • Fluorescence microscopy to track protein localization

    • Sucrose gradient fractionation to assess membrane association

    • Protease protection assays to verify proper topology

  • Functional verification: Measure ATP synthesis activity in reconstituted systems using luciferase-based ATP detection assays.

This approach is supported by studies on other magnetosome-associated proteins that have been successfully reconstituted in vitro . The unique lipid composition of magnetosome membranes should be characterized and maintained during these experiments to ensure physiological relevance.

What is the role of atpB in the energetics of iron transport during magnetosome formation?

The energetics of iron transport during magnetosome formation likely involves atpB and the ATP synthase complex in several ways:

  • Proton motive force generation: ATP synthase generates the proton gradient that drives many secondary transporters, potentially including those involved in iron uptake for magnetosome formation.

  • Direct ATP provision: Iron transport systems may require ATP hydrolysis, which would be provided by the ATP synthase complex.

  • pH regulation: The atpB subunit is involved in proton translocation, which could help maintain optimal pH conditions within the magnetosome for iron biomineralization.

Experimental approaches to investigate this connection include:

  • Using ATP synthase inhibitors (e.g., oligomycin) to assess their impact on iron uptake and magnetosome formation

  • Creating conditional atpB mutants to determine how reduced ATP synthase activity affects iron transport

  • Measuring intracellular ATP levels and membrane potential during different stages of magnetosome formation

  • Conducting co-immunoprecipitation studies to identify potential interactions between atpB and iron transport proteins

Research has shown that disruption of the global regulator Crp, which controls ATP synthase gene expression, leads to decreased ferromagnetism and intracellular iron content in magnetotactic bacteria , supporting the critical role of energy metabolism in magnetosome formation.

What are the optimal conditions for assaying recombinant M. magneticum atpB activity in vitro?

Optimal conditions for assaying recombinant M. magneticum atpB activity include:

ParameterRecommended ConditionNotes
pH7.0-7.5Buffer with 50 mM MOPS or HEPES
Temperature28-30°CCorresponds to optimal growth temperature of M. magneticum
Ions2-5 mM Mg²⁺, 50-100 mM Na⁺ or K⁺Mg²⁺ is essential for ATP binding
Substrates1-5 mM ATP for hydrolysis assaysConsider using [γ-³²P]ATP for high sensitivity
Detergent0.02-0.05% DDM or LDAOMaintain protein stability without inhibiting activity
Redox conditionsSlightly reducing environmentAdd 1-5 mM DTT or 2-mercaptoethanol

For ATP synthesis assays, reconstitute the purified protein into liposomes with a defined composition (e.g., E. coli lipids supplemented with cardiolipin) and establish a proton gradient by acidification followed by buffer exchange. ATP synthesis can then be monitored using the luciferase-based ATP detection system.

Given the connection between magnetosome formation and energy metabolism in M. magneticum , experimental conditions should also consider the potential influence of iron concentration and redox state on atpB activity.

How can I analyze the interaction between atpB and other components of the magnetosome formation machinery?

To analyze interactions between atpB and magnetosome formation components:

  • Co-immunoprecipitation (Co-IP): Use antibodies against atpB or against magnetosome proteins to pull down protein complexes from cell lysates, followed by mass spectrometry identification of interacting partners.

  • Bacterial two-hybrid system: Engineer fusion constructs of atpB and suspected interacting partners with complementary fragments of a reporter protein (e.g., adenylate cyclase) to detect interactions in vivo.

  • Fluorescence resonance energy transfer (FRET): Express atpB and potential partners as fusions with compatible fluorescent proteins (e.g., CFP/YFP) to detect proximity-based energy transfer in living cells.

  • Cross-linking mass spectrometry: Use chemical cross-linkers to capture transient interactions, followed by mass spectrometry to identify the interacting proteins and their contact sites.

  • Surface plasmon resonance (SPR): Immobilize purified atpB on a sensor chip and flow potential interacting partners over it to measure binding kinetics.

Recent studies on magnetosome-associated proteins have identified numerous protein-protein interactions critical for magnetosome formation . For example, MamK interacts with MamJ to anchor magnetosomes to a filamentous cytoskeletal structure , suggesting that similar specific interactions might exist between atpB and the magnetosome formation machinery.

What genetic tools are available for manipulating atpB expression in M. magneticum?

Several genetic tools are available for manipulating atpB expression in M. magneticum:

  • Homologous recombination-based gene replacement: Replace the native atpB gene with a modified version containing point mutations or deletions. This approach has been used successfully for other magnetosome-associated genes .

  • Inducible expression systems: Use tetracycline- or IPTG-inducible promoters to control atpB expression levels. The Tet system has been adapted for use in magnetotactic bacteria.

  • CRISPR-Cas9 genome editing: Recent adaptations of CRISPR systems for alphaproteobacteria can be applied to M. magneticum for precise editing of atpB.

  • Transformation-associated recombination (TAR) cloning: This method has been used successfully to assemble and express entire magnetosome gene clusters and could be applied to create various atpB constructs.

  • Complementation systems: M. gryphiswaldense has been demonstrated as a suitable surrogate host for expressing foreign magnetosome genes , which can be leveraged for atpB expression studies.

When designing genetic manipulation strategies, it's important to consider that disruption of atpB may impact cell viability due to its essential role in energy metabolism, necessitating conditional or partial disruption approaches.

How can I distinguish between direct and indirect effects of atpB mutations on magnetosome formation?

Distinguishing between direct and indirect effects of atpB mutations requires a multi-faceted approach:

  • Conditional expression systems: Use tightly controlled inducible promoters to rapidly modulate atpB expression and monitor immediate versus delayed effects on magnetosome formation.

  • Separation of function mutations: Design mutations that specifically affect aspects of atpB function (e.g., ATP synthesis versus proton translocation) to determine which activities are essential for magnetosome formation.

  • Metabolic bypass strategies: Provide alternative energy sources or create genetic bypasses for ATP production to determine if the effects of atpB mutation can be suppressed.

  • Real-time monitoring: Use time-lapse microscopy with fluorescently tagged magnetosome proteins to track the temporal sequence of events following atpB perturbation.

  • Quantitative measurements: Assess multiple parameters including:

    • Cellular ATP levels

    • Proton motive force

    • Iron transport rates

    • Magnetosome size and number

    • Magnetite crystal structure

Research on other magnetosome-associated proteins has shown that energy metabolism and magnetosome formation are tightly linked . For example, disruption of the global regulator Crp affects both energy metabolism genes and magnetosome island genes, leading to defects in magnetosome synthesis . This suggests that atpB mutations might similarly have both direct energetic effects and indirect regulatory impacts.

How can structural information about M. magneticum atpB contribute to understanding ATP synthase adaptation in specialized bacteria?

Structural characterization of M. magneticum atpB can provide insights into ATP synthase adaptation in several ways:

  • Specialized membrane interactions: The structure might reveal adaptations for functioning within the unique lipid environment of magnetosome membranes, potentially showing modified hydrophobic surfaces or specific lipid-binding sites.

  • Iron metabolism integration: Structural features could indicate how ATP synthase activity is coordinated with iron transport and biomineralization, possibly through unique binding interfaces or regulatory domains.

  • Redox sensitivity: The structure might reveal adaptations that allow the ATP synthase to function optimally in the redox environment required for magnetite formation, such as protected cysteine residues or unique metal-binding sites.

Methods for structural determination should include:

  • X-ray crystallography of purified protein (challenging for membrane proteins)

  • Cryo-electron microscopy of the entire ATP synthase complex

  • NMR studies of soluble domains

  • Molecular dynamics simulations based on homology models

Comparative structural analysis with ATP synthases from non-magnetotactic bacteria would highlight the specific adaptations in M. magneticum, potentially revealing evolutionary strategies for energy metabolism in specialized bacterial systems.

What insights can be gained from comparing atpB sequences across different magnetotactic bacterial species?

Comparative analysis of atpB sequences across magnetotactic bacteria can provide valuable insights:

SpeciesKey atpB FeaturesMagnetosome CharacteristicsCorrelation
M. magneticum AMB-1[Specific sequence features]Cubo-octahedral magnetite crystals[Potential adaptation relationships]
M. gryphiswaldense MSR-1[Specific sequence features]Cubo-octahedral magnetite crystals[Potential adaptation relationships]
Magnetovibrio blakemorei[Specific sequence features]Different crystal morphology[Potential adaptation relationships]
Non-magnetotactic relatives[Specific sequence features]No magnetosomes[Baseline comparison]

This comparative approach can:

  • Identify conserved regions specific to magnetotactic bacteria

  • Highlight correlations between atpB sequence variations and magnetosome properties

  • Inform directed evolution experiments to engineer ATP synthases with desired properties

Functional expression studies have shown that magnetosome genes from different species can be expressed in surrogate hosts like M. gryphiswaldense , suggesting that similar approaches could be used to express and characterize atpB variants from diverse magnetotactic bacteria.

How might atpB function be integrated into synthetic biology applications involving engineered magnetotactic bacteria?

The integration of atpB function into synthetic biology applications offers several promising avenues:

  • Engineered energy metabolism: Modify atpB to optimize ATP production under specific conditions, enhancing the viability of engineered magnetotactic bacteria in various environments.

  • Controlled magnetosome production: Develop systems where atpB expression or activity regulates magnetosome formation, creating inducible magnetism for applications like cell sorting or targeted delivery.

  • Biosensors: Engineer atpB variants sensitive to specific environmental conditions (pH, redox, metabolites) that modulate ATP synthesis and thereby magnetosome formation, creating bacteria that respond magnetically to stimuli.

  • Nanoparticle production control: Create feedback systems where atpB activity influences the size, shape, or composition of magnetite nanoparticles, allowing fine-tuned control of their magnetic properties.

Implementation of these applications would benefit from the transformation-associated recombination (TAR) cloning approach that has been used to successfully assemble and express entire magnetosome gene clusters . This would allow for the creation of portable versions of atpB and related genes that could be transferred to various chassis organisms.

What experimental approaches can elucidate the evolutionary relationship between ATP synthesis and magnetosome formation?

To investigate the evolutionary relationship between ATP synthesis and magnetosome formation:

  • Phylogenetic analysis: Construct comprehensive phylogenetic trees of atpB and magnetosome genes across bacterial species to identify patterns of co-evolution.

  • Ancestral sequence reconstruction: Computationally infer ancestral atpB sequences at key evolutionary nodes and express these reconstructed proteins to test their functionality in modern magnetotactic bacteria.

  • Horizontal gene transfer assessment: Analyze genomic signatures to determine if atpB or magnetosome genes show evidence of horizontal transfer between bacterial lineages.

  • Minimal gene set experiments: Systematically express combinations of magnetosome genes along with different ATP synthase variants to determine the minimal requirements for magnetosome formation.

  • Comparative genomics: Analyze the genomic context of atpB across species with different magnetosome properties to identify potential regulatory relationships.

Research has shown that magnetosome formation genes are clustered in genomic islands , suggesting they may have been acquired as modules during evolution. Understanding how these specialized systems became integrated with core metabolic machinery like ATP synthase could provide insights into the adaptability of bacterial energy systems.

What are the current knowledge gaps in understanding M. magneticum atpB function and its relationship to magnetosome formation?

Despite progress in understanding magnetotactic bacteria, several knowledge gaps remain regarding M. magneticum atpB:

  • The precise localization of atpB within the cell (whether it's present in both cytoplasmic and magnetosome membranes)

  • The specific interactions between atpB and magnetosome-associated proteins

  • How the ATP synthase complex is regulated during different phases of magnetosome formation

  • Whether there are structural adaptations in atpB that specifically support magnetosome energetics

  • The exact energy requirements for different stages of magnetosome formation and how atpB activity is coordinated with these requirements

Addressing these knowledge gaps will require integrated approaches combining structural biology, genetics, biochemistry, and advanced imaging techniques. Future research should focus on developing new tools for studying membrane protein dynamics in magnetotactic bacteria and establishing quantitative methods to measure energy flux during magnetosome formation.

What are promising future research directions for studying recombinant M. magneticum atpB?

Several promising research directions for studying recombinant M. magneticum atpB include:

  • Cryo-electron microscopy studies: Determine the structure of ATP synthase within the context of magnetosome membranes to identify unique adaptations.

  • Single-molecule biophysics: Apply techniques like FRET, optical tweezers, or nanodiscs combined with electrical recordings to study the mechanics and energetics of M. magneticum ATP synthase at the molecular level.

  • Systems biology approaches: Develop comprehensive models of energy flow during magnetosome formation, integrating data on ATP synthase activity with iron transport and biomineralization processes.

  • Synthetic biology applications: Engineer modified versions of atpB with enhanced properties or novel regulatory features for biotechnological applications.

  • Comparative studies across diverse magnetotactic bacteria: Expand analysis to unusual magnetotactic bacteria from extreme environments to discover novel adaptations of ATP synthase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.