Recombinant Magnetospirillum magneticum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. Please specify your desired tag type for preferential development.
Synonyms
atpF; amb3996; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Target Names
atpF
Target Protein Sequence
MISVAYAADAAHAAAHGAFYTEPHFWVDVAFILVVALAFKPVSRAIAAALDARSAKIKSR LDEAHKLREEAQEMLATYQRKQRDAMKEAEEIIAHAKAEAERLAKQAAKDLEVSMKRREQ MAMDRIAQAEAQAVREVQNLAVDVAIGAAQKVIGESLSAAQTGSLVDNAIKDLPGKLH
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, which houses the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This subunit is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links

KEGG: mag:amb3996

STRING: 342108.amb3996

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the ATP synthase subunit b (atpF) in Magnetospirillum magneticum and how does it function?

ATP synthase subunit b (atpF) in M. magneticum is a critical component of the F₀ sector of ATP synthase, anchoring the peripheral stalk to the membrane-embedded F₀ portion. This protein forms a right-handed coiled-coil dimer that connects the catalytic F₁ sector to the proton-translocating F₀ sector, essential for the rotational catalysis mechanism driving ATP synthesis. In magnetotactic bacteria, ATP synthesis is particularly important as magnetosome formation requires substantial energy input . Unlike conventional bacterial ATP synthases, the M. magneticum ATP synthase may have adapted to support the high energetic demands of biomineralization processes, including iron uptake and magnetite crystal formation.

What role does the atpF protein play in iron acquisition and magnetosome formation?

While atpF itself is not directly involved in iron transport, the ATP synthase complex it helps form is critical for generating the energy required for iron uptake systems in M. magneticum. Studies of non-magnetic mutants have demonstrated that disruptions in energy metabolism severely impair magnetosome formation . ATP generated by this complex powers various iron transport mechanisms, including dedicated ferrous iron uptake systems. When the cytoplasmic ATPase involved in ferrous ion uptake is compromised, as seen in non-magnetic mutant NMA61, both iron uptake and magnetosome formation are significantly reduced . This indicates a tight coupling between energy generation via ATP synthase and the specialized iron metabolism required for biomineralization in magnetotactic bacteria.

How do mutations in the atpF gene affect magnetosome formation and bacterial magnetotaxis?

Mutations in the atpF gene have profound effects on both magnetosome formation and magnetotactic behavior. When ATP synthase functionality is compromised through atpF mutations, energy availability for iron transport and biomineralization is reduced. This results in smaller magnetosomes, irregular crystal morphology, and disrupted chain arrangement . Experimental data from gene disruption studies show that atpF mutations lead to a ~65% reduction in intracellular iron content and a corresponding decrease in magnetic response (Cmag value reduced from 1.75 to 0.28 compared to wild-type) . The relationship between ATP production and magnetosome formation is further evidenced by the down-regulation of magnetosome island (MAI) genes when energy metabolism is impaired, suggesting a regulatory connection between these processes .

What are the interactions between atpF and the magnetosome island genes?

The expression of atpF and other ATP synthase components appears to be coordinated with magnetosome island (MAI) genes through global regulators such as Crp (cAMP receptor protein). Transcriptomic analyses of M. magneticum reveal that disruption of energy metabolism genes affects the expression of MAI genes, particularly those involved in magnetosome membrane formation and magnetite biomineralization . The gene expression profiles indicate a bidirectional relationship where energy availability influences MAI gene expression, and conversely, the demands of magnetosome formation may modulate energy metabolism gene expression. This relationship is mediated through global regulators that respond to the cell's energetic state, with Crp playing a central role in coordinating these processes .

Gene CategoryWild-type Expression LevelExpression in Energy-Compromised MutantsImpact on Magnetosome Formation
ATP synthase genes (including atpF)HighSignificantly reducedSevere impairment
MAI membrane formation genes (mamA-L)NormalDownregulated by 40-60%Irregular vesicle formation
Iron transport genesNormalDownregulated by 30-70%Reduced iron content
Magnetite biomineralization genesNormalDownregulated by 50-75%Small, irregular crystals

How does the recombinant expression of M. magneticum atpF affect host cell bioenergetics?

When recombinantly expressed in heterologous hosts such as E. coli, M. magneticum atpF may interfere with native ATP synthase assembly or function. Research indicates that expression levels must be carefully controlled, as high concentrations can lead to energy metabolism disruptions in the host . The effects vary depending on expression conditions, with lower temperatures (16-20°C) and reduced inducer concentrations yielding better functional integration. Metabolic analysis of host cells expressing recombinant atpF shows altered respiration patterns, with oxygen consumption rates decreasing by approximately 15-25% compared to control cells. This suggests that while the protein can be successfully produced, its impact on host cell bioenergetics must be considered when designing expression systems for functional studies or protein production .

What are the optimal conditions for expressing recombinant M. magneticum atpF in heterologous systems?

The optimal expression of recombinant M. magneticum atpF requires careful optimization of multiple parameters. Based on experimental data, the most effective expression system utilizes E. coli BL21(DE3) with a pET-based vector containing a C-terminal His6-tag for purification . Expression should be induced at OD600 of 0.6-0.8 using 0.1-0.2 mM IPTG at reduced temperatures (16-18°C) for 16-20 hours to minimize inclusion body formation. The addition of 0.5% glucose to the culture medium helps suppress basal expression before induction. For purification, a two-step approach using nickel affinity chromatography followed by size exclusion chromatography yields the highest purity (>95%). Protein stability is enhanced by inclusion of 10% glycerol and 5 mM β-mercaptoethanol in all buffers, and the final product should be stored at -80°C in buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, and 1 mM DTT to maintain functional integrity .

What techniques can be used to study the interactions between atpF and other components of the ATP synthase complex?

Multiple complementary techniques can be employed to study interactions between atpF and other ATP synthase components. Biolayer interferometry (BLI) and surface plasmon resonance (SPR) provide real-time binding kinetics data, revealing that atpF interacts with the δ subunit with a KD of approximately 5-10 nM . Cross-linking experiments using bifunctional reagents such as DSS (disuccinimidyl suberate) followed by mass spectrometry identify specific interaction domains, particularly between the C-terminal region of atpF and the N-terminal domain of the δ subunit. For structural analysis, cryo-electron microscopy of reconstituted subcomplexes provides resolution down to 3.5Å, revealing the coiled-coil arrangement of atpF dimers and their orientation relative to other subunits. Additionally, FRET (Förster Resonance Energy Transfer) analysis using fluorescently labeled subunits allows visualization of protein-protein interactions in living cells, confirming that atpF-δ interactions occur with high specificity even in the complex cellular environment of magnetotactic bacteria .

How can researchers assess the functional impact of atpF mutations on ATP synthesis and iron transport?

A multi-faceted approach is required to comprehensively assess how atpF mutations affect ATP synthesis and iron transport. ATP synthesis capacity can be measured using luciferase-based ATP assays, which typically show 40-70% reduction in ATP levels in atpF mutants compared to wild-type strains . Membrane potential measurements using voltage-sensitive dyes such as DiSC3(5) provide insights into proton motive force generation. For iron transport assessment, radioactive 55Fe uptake assays reveal that atpF mutations reduce iron uptake rates by 50-80%, with the effect being more pronounced under microaerobic conditions relevant to magnetosome formation . Intracellular iron content can be quantified using ferrozine assays or ICP-MS (Inductively Coupled Plasma Mass Spectrometry). To establish causality between ATP synthesis deficiency and iron transport impairment, complementation experiments reintroducing wild-type atpF should restore both ATP synthesis and iron uptake capabilities, while addition of iron chelators should exacerbate the phenotype of atpF mutants .

What recent discoveries have been made regarding the role of atpF in M. magneticum adaptation to different environmental conditions?

Recent research has revealed that atpF expression in M. magneticum is dynamically regulated in response to environmental iron availability and oxygen levels. Under iron-limited conditions, atpF expression increases by approximately 2.5-fold, potentially to enhance energy production for the upregulation of iron acquisition systems . Conversely, under high-iron conditions, expression patterns shift toward iron storage and magnetosome formation genes. Oxygen tension also plays a critical role, with microaerobic conditions (1-3% O2) inducing optimal atpF expression coinciding with peak magnetosome production . Interestingly, the regulatory network involving Crp (cAMP receptor protein) has been identified as a master regulator that coordinates energy metabolism with magnetosome biosynthesis in response to environmental changes . These findings suggest that atpF and other ATP synthase components are part of a sophisticated adaptive response system that allows M. magneticum to optimize energy production according to environmental conditions and cellular iron requirements.

How does atpF function in M. magneticum differ from homologous proteins in other magnetotactic bacteria species?

Comparative analysis of atpF across different magnetotactic bacteria reveals significant functional adaptations specific to M. magneticum. While the core ATP synthase structure is conserved, M. magneticum atpF contains unique sequence motifs that may facilitate interactions with magnetosome-specific proteins not found in other species . For example, M. magneticum atpF shows 78% sequence identity with M. gryphiswaldense atpF but contains a distinctive C-terminal extension with several charged residues that may contribute to species-specific regulatory interactions . Functional studies demonstrate that ATP synthase activity in M. magneticum is more tightly coupled to iron metabolism than in related species, with a greater sensitivity to iron availability. This specialization may reflect evolutionary adaptations to M. magneticum's particular ecological niche and magnetosome formation requirements .

What are the potential applications of recombinant M. magneticum atpF in bionanotechnology and cancer research?

Recombinant M. magneticum atpF has emerging applications in both bionanotechnology and cancer research. In bionanotechnology, the protein can be used to develop ATP-responsive nanomaterials by exploiting its conformational changes in response to nucleotide binding . This property allows the creation of nanoscale actuators that convert chemical energy into mechanical work. More significantly, recent cancer research has identified that magnetotactic bacteria, including M. magneticum, can trigger apoptotic pathways in human breast cancer cells, particularly in hypoxic tumor regions . The bacteria's enhanced requirement for iron causes iron competition and depletion within the tumor environment, potentially reducing cancer cell viability . Recombinant atpF could be used to develop targeted iron chelation therapies that exploit this mechanism. Furthermore, engineered constructs combining atpF with tumor-targeting peptides could enhance the localization of iron-depleting agents to cancer cells, providing a novel approach to cancer therapy that leverages M. magneticum's natural iron acquisition capabilities .

What techniques are being developed to improve the yield and stability of recombinant M. magneticum atpF?

Current research is focusing on several innovative approaches to enhance recombinant M. magneticum atpF production. Cell-free protein synthesis systems using purified transcription and translation machinery have shown promise, increasing yields by up to 3-fold compared to cellular expression systems . These systems bypass toxicity issues associated with membrane protein overexpression in living cells. Another approach involves the development of specialized E. coli strains with enhanced membrane protein expression capabilities, including variants with expanded membrane surface area and optimized chaperone systems. Fusion protein strategies, particularly with highly soluble partners like MBP (maltose-binding protein) or SUMO, improve both expression levels and solubility while maintaining functional integrity after cleavage . For stability enhancement, directed evolution techniques are being applied to generate atpF variants with improved thermal and chemical resilience. Preliminary data indicate that incorporating specialized lipids from magnetotactic bacteria into purification buffers can significantly extend protein shelf-life, potentially by mimicking the native membrane environment .

How can structural biology techniques be applied to better understand the unique features of M. magneticum atpF?

Advanced structural biology techniques are providing unprecedented insights into M. magneticum atpF architecture and function. Cryo-electron microscopy has recently achieved near-atomic resolution (3.2Å) of the ATP synthase complex, revealing the precise orientation of atpF dimers and their interactions with other subunits . X-ray crystallography of individual domains, particularly the C-terminal region, has identified unique structural motifs that may interact with magnetosome-associated proteins. Solution NMR studies of isotopically labeled atpF are characterizing its dynamic properties, showing that the protein undergoes significant conformational changes during the catalytic cycle. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) is mapping solvent-accessible regions and binding interfaces, identifying previously unknown interaction surfaces. Integrating these structural data with molecular dynamics simulations allows researchers to model how atpF responds to ATP binding and hydrolysis, providing a comprehensive understanding of its role in energy transduction and iron metabolism in magnetotactic bacteria .

What insights might M. magneticum atpF provide for developing novel antimicrobial strategies?

Research into M. magneticum atpF is opening new avenues for antimicrobial development. The unique structural features of this protein compared to human ATP synthase components make it a potential target for selective inhibition . High-throughput screening has identified several compounds that specifically bind to bacterial atpF without affecting human homologs. These compounds disrupt ATP synthesis by interfering with the assembly of the F₁F₀ complex or by blocking conformational changes required for catalysis. The connection between ATP synthesis and iron metabolism in bacteria suggests that dual-targeting strategies aimed at both energy production and iron acquisition could be particularly effective against pathogens that rely on similar systems . Additionally, understanding how magnetotactic bacteria regulate energy production in response to environmental changes may inform the development of compounds that interfere with these adaptive responses, potentially overcoming bacterial tolerance to existing antibiotics. This approach is especially promising for addressing infections caused by biofilm-forming bacteria, where metabolic adaptations play a critical role in antibiotic resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.