Recombinant Magnetospirillum magneticum ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock
Cat. No.
BT2036885
Source
in vitro E.coli expression system
Synonyms
atpE; amb3994; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Quick Inquiry

Description

Functional Role in Energy Metabolism

ATP synthase subunit c is integral to the F₀ sector, mediating proton translocation across the membrane during oxidative phosphorylation. This process generates a proton motive force (PMF), driving ATP synthesis. In Magnetospirillum magneticum, ATP synthase activity supports energy-intensive processes, including magnetosome biomineralization .

Key Research Findings

  1. Energy Metabolism and Magnetosome Formation

    • Disruption of the global regulator crp in Magnetospirillum gryphiswaldense MSR-1 downregulates ATP synthase genes, impairing magnetosome synthesis. This highlights the interdependence of energy metabolism and magnetosome biogenesis .

    • ATP synthase activity ensures sufficient ATP for iron transport and redox processes critical for magnetite crystal formation .

  2. Protein Interactions and Localization

    • Subunit c forms part of the c-ring structure in ATP synthase, working with subunits a and b to facilitate proton translocation. In M. magneticum, this mechanism could influence intracellular pH and redox conditions, indirectly supporting magnetosome maturation .

Experimental Uses

ApplicationDescription
Biochemical AssaysStudying proton translocation kinetics, subunit assembly, and ATP synthesis efficiency.
Structural StudiesCrystallization for X-ray diffraction or cryo-EM to resolve F₀ sector architecture.
Gene Regulation StudiesInvestigating crp-mediated transcriptional control of ATP synthase genes .

Potential Innovations

  • Magnetosome Engineering: Understanding ATP synthase’s role in energy homeostasis could inform strategies to enhance magnetosome production for biomedical applications (e.g., drug delivery).

  • Bioenergy Research: Insights into proton translocation mechanisms may advance biofuel cell designs or microbial energy systems.

Research Challenges and Future Directions

  • Functional Redundancy: Overlapping roles of ATP synthase subunits in different bacterial species complicate targeted mutational studies .

  • In Vivo Relevance: While recombinant atpE enables in vitro studies, its behavior in native M. magneticum membranes remains underexplored.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpE; amb3994; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-74
Protein Length
full length protein
Species
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Target Names
atpE
Target Protein Sequence
MEASAAKFIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPSAKANVELYGWIGFAVTEAI ALFALVVALMVLFA
Uniprot No.
Q2W027

Target Background

Function
F(1)F(0) ATP synthase generates ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the F(0) channel and plays a direct role in proton translocation across the membrane. A homomeric c-ring composed of 10-14 subunits forms the central stalk rotor element along with the F(1) delta and epsilon subunits.
Database Links

KEGG: mag:amb3994

STRING: 342108.amb3994

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.