Recombinant Magnetospirillum magneticum Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format we currently have in stock, we understand that you may have specific requirements. Please include any format preferences in your order notes, and we will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Should you require dry ice shipping, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
plsY; amb3613; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Target Names
plsY
Target Protein Sequence
MLELVAATLGGYLLGSVPFGLVLTRLAGLGDIRQIGSGNIGATNVLRTGRKGLALATLLL DGGKGAIAVGLVWVLLGREMVPVAGFAAVLGHNFPVWLGFKGGKGVATTIGTLLAAAWPV GLACIGTWLVSAAIFRISSLSALIALAASPGFALYFAGPQYALMAAGLAVMGFYRHKANI IRLIRGEEPRIGGKKKTESEG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: mag:amb3613

STRING: 342108.amb3613

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Magnetospirillum magneticum and why is it significant for research?

M. magneticum AMB-1 is a freshwater species of magnetotactic bacteria (MTB) with spirillum morphology that synthesizes truncated-octahedral magnetosomes with a slight distortion and a mean size of approximately 40-45 nm. Unlike other similar spirillum species such as M. gryphiswaldense MSR-1, AMB-1 synthesizes fragmental chains instead of a long continuous chain . This unique characteristic makes it valuable for studying biomineralization processes and magnetic properties applicable to biomedical applications including magnetic hyperthermia .

What is the functional role of Glycerol-3-phosphate acyltransferase (plsY) in bacterial systems?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the initial step in phospholipid biosynthesis by transferring an acyl group from acyl-ACP to glycerol-3-phosphate, forming lysophosphatidic acid. In magnetotactic bacteria like M. magneticum, this enzyme is particularly important as it likely contributes to the specialized membrane composition required for magnetosome formation, which involves invagination of the cytoplasmic membrane to create the magnetosome vesicle where biomineralization occurs.

How does the magnetosome membrane composition differ from the cytoplasmic membrane in M. magneticum?

The magnetosome membrane in M. magneticum contains a distinct protein and lipid composition compared to the cytoplasmic membrane. While specific details about plsY's contribution to this difference aren't fully characterized, research suggests that magnetosome membranes have unique phospholipid compositions that may influence membrane curvature, fluidity, and the ability to nucleate magnetite crystals. Understanding plsY's role could provide insights into how this specialized membrane compartment is generated and maintained.

Which E. coli strains are most effective for expressing recombinant M. magneticum plsY?

For expressing plsY from M. magneticum, B strains of E. coli are generally preferred over K12 strains, with BL21(DE3) being the most widely employed strain (used in 65% of recombinant expression cases according to systematic reviews) . BL21(DE3) offers several advantages including:

  • Deficiency in Lon and OmpT proteases, providing protection to potentially misfolded proteins

  • Short doubling time (~20 minutes) coupled with rapid protein synthesis via the T7 expression system

  • Higher biomass generation compared to K12 strains

For membrane proteins like plsY that may pose expression challenges, specialized strains should be considered:

StrainBenefits for plsY expression
BL21(DE3)pLysSLower background expression, useful if plsY is toxic to cells
C41(DE3)/C43(DE3)Specially designed for membrane protein expression
ArcticExpress(DE3)Expression at low temperatures with active chaperones to promote folding
Rosetta(DE3)Supplies rare codons that might be abundant in M. magneticum genes
Origami B(DE3)Promotes disulfide bond formation if relevant to plsY structure

What vectors and fusion tags optimize soluble expression of recombinant plsY?

When expressing membrane-associated proteins like plsY, vector selection and fusion tag strategy are critical:

  • Vector considerations:

    • pET series vectors with T7 promoter provide strong, inducible expression

    • pBAD vectors offer more finely-tuned expression through arabinose induction

    • Low to medium copy number vectors may reduce expression burden

  • Recommended fusion tags for membrane proteins:

Fusion TagPositionBenefits for plsY
MBP (Maltose-Binding Protein)N-terminalHighly soluble, enhances folding, potential affinity purification
SUMON-terminalPromotes folding, removable without residual amino acids
Thioredoxin (Trx)N-terminalEnhances solubility and prevents inclusion bodies
His6/His10Either endFacilitates purification, smaller size minimizes interference
Strep-tag IIC-terminalGentle elution conditions preserve activity
  • Cleavage considerations:

    • Include a protease cleavage site (TEV, PreScission, SUMO protease) between tag and protein

    • Position the cleavage site to ensure complete removal of the tag without affecting protein function

How can growth conditions be optimized to maximize yield of functional recombinant plsY?

Based on research with M. magneticum and membrane proteins, several parameters should be systematically optimized:

  • Media composition:

    • Test different media formulations (similar to how M. magneticum properties are affected by MSGM+W, MSGM-W, and FSM media)

    • Consider supplementation with phospholipids or specific ions that might stabilize plsY

  • Growth temperature profile:

    • Grow cultures at 37°C until induction, then shift to 16-25°C for protein expression

    • Lower temperatures slow protein synthesis, allowing more time for proper folding and membrane insertion

  • Induction parameters:

    • Test IPTG concentrations from 0.1-1.0 mM

    • Consider extended expression periods (16-24 hours) at lower temperatures

    • Auto-induction media may provide more gradual protein expression

  • Additives that may improve folding:

    • Glycerol (5-10%) to stabilize membranes

    • Low concentrations of specific detergents (below CMC)

    • Known plsY substrates or products at low concentrations

What is the most effective extraction and purification protocol for maintaining plsY activity?

Purification of membrane-associated plsY requires careful consideration of membrane extraction and protein stability:

  • Cell lysis options:

    • Gentle methods like enzymatic lysis with lysozyme followed by mechanical disruption

    • Osmotic shock may help release peripheral membrane proteins

    • French press or sonication with temperature control to prevent denaturation

  • Membrane protein extraction:

    • Screen detergents systematically (mild non-ionic detergents like DDM, LMNG, or Triton X-100)

    • Alternative solubilization with amphipols or nanodiscs to maintain native-like environment

    • Consider detergent:protein ratios carefully to prevent aggregation

  • Chromatography strategy:

Purification StepMethodConsiderations for plsY
Initial captureIMAC (for His-tagged plsY)Include detergent in all buffers; use gradient elution
IntermediateIon exchange chromatographyRemove nucleic acid contamination; separate protein variants
PolishSize exclusion chromatographyAssess oligomeric state; remove aggregates
FinalAffinity chromatography (if applicable)Remove tag if necessary for activity assessment
  • Buffer optimization:

    • pH based on theoretical pI of plsY

    • Ionic strength to maintain solubility without disrupting protein-lipid interactions

    • Glycerol (10-20%) for stability

    • Reducing agents if cysteine residues are present

How can the enzymatic activity of purified recombinant plsY be reliably measured?

Given plsY's function as a glycerol-3-phosphate acyltransferase, several complementary activity assays can be employed:

  • Direct activity measurement:

    • Radiometric assay using 14C-labeled glycerol-3-phosphate or acyl-ACP

    • HPLC or LC-MS detection of lysophosphatidic acid formation

    • Colorimetric coupling to detect released CoA-SH (if using acyl-CoA as substrate)

  • Standard enzymatic assay conditions:

ParameterRecommended RangeNotes
Temperature25-37°CMatch M. magneticum optimal growth temperature
pH7.0-8.0Test narrow range to determine optimum
G3P concentration0.1-2 mMDetermine Km through saturation curve
Acyl donor concentration0.1-1 mMTest various chain length acyl donors
Divalent cations1-10 mM Mg2+May be required for optimal activity
  • Alternative approaches:

    • Binding assays using isothermal titration calorimetry

    • Thermal shift assays to assess substrate-induced stabilization

    • Surface plasmon resonance for kinetic binding parameters

What analytical methods can confirm the structural integrity of purified plsY?

Multiple biophysical techniques should be employed to verify proper folding and structural characteristics:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure composition

    • Fluorescence spectroscopy if plsY contains tryptophans near the active site

    • FTIR spectroscopy specifically for membrane proteins to analyze secondary structure

  • Mass spectrometry applications:

    • Intact mass analysis to confirm correct molecular weight

    • Peptide mapping to verify sequence coverage

    • Hydrogen-deuterium exchange to probe structural dynamics

    • Crosslinking mass spectrometry to identify domain interactions

  • Functional confirmation:

    • Thermal denaturation profile compared to predicted stability

    • Binding of known substrate analogs

    • Activity correlation with structural parameters

What strategies can overcome inclusion body formation during recombinant plsY expression?

Inclusion body formation is a common challenge with membrane proteins like plsY. Based on systematic reviews of recombinant expression , several approaches can mitigate this issue:

  • Strain engineering approaches:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Use specialized strains like ArcticExpress that express cold-adapted chaperones

    • Consider Origami strains if disulfide bonds are critical for folding

  • Expression modification:

    • Lower IPTG concentration (0.01-0.1 mM) for slower expression

    • Reduce growth temperature to 15-20°C after induction

    • Use auto-induction media for gradual protein production

    • Adjust growth phase at induction (mid-log phase typically optimal)

  • Refolding strategies if inclusion bodies persist:

    • Solubilize inclusion bodies with 8M urea or 6M guanidine-HCl

    • Refold by gradual dialysis in the presence of appropriate detergents

    • Add phospholipids during refolding to facilitate proper membrane protein folding

    • Include osmolytes like glycerol, sucrose, or arginine to prevent aggregation

  • Construct optimization:

    • Test different fusion tag combinations

    • Remove potential problematic domains through truncation analysis

    • Codon-optimize the gene for E. coli expression

How can the purity and homogeneity of plsY preparations be assessed?

Multiple orthogonal techniques should be employed to comprehensively analyze protein quality:

  • Electrophoretic methods:

    • SDS-PAGE with both Coomassie and silver staining

    • Native PAGE to assess oligomeric state

    • Western blotting with anti-His (or other tag) antibodies

  • Chromatographic approaches:

    • Analytical size exclusion chromatography

    • Reverse-phase HPLC

    • Multi-angle light scattering (MALS) to determine absolute molecular weight

  • Contaminant identification:

    • Mass spectrometry to identify co-purifying proteins

    • Endotoxin testing if required for downstream applications

    • Phospholipid analysis to assess co-purifying lipids

  • Homogeneity assessment:

    • Dynamic light scattering to analyze particle size distribution

    • Analytical ultracentrifugation to characterize solution behavior

What are common pitfalls in kinetic analysis of recombinant plsY and how can they be avoided?

When characterizing enzymatic parameters of plsY, several factors can complicate analysis:

  • Substrate considerations:

    • Limited solubility of acyl substrates may necessitate detergent inclusion

    • Substrate micelle formation above critical concentrations can affect kinetics

    • Substrate depletion or product inhibition during longer assays

  • Data analysis challenges:

    • Potential non-Michaelis-Menten kinetics due to membrane environment

    • Cooperative binding effects with lipid substrates

    • Multiple binding sites or alternative reaction mechanisms

  • Recommended controls and validations:

    • Generate a catalytically inactive mutant (e.g., active site mutation) as negative control

    • Verify linearity of activity with enzyme concentration

    • Ensure time-dependent measurements remain in initial velocity range

    • Account for potential detergent effects on substrate availability

How can recombinant plsY be used to investigate magnetosome formation in M. magneticum?

Understanding plsY's role in magnetosome biogenesis requires sophisticated experimental approaches:

  • Genetic complementation studies:

    • Generate plsY knockout in M. magneticum and assess magnetosome phenotype

    • Complement with wild-type or mutant plsY variants

    • Quantify changes in magnetosome number, size, and organization

  • Lipid composition analysis:

    • Compare lipid profiles of magnetosome membranes in wild-type and plsY-modified strains

    • Identify specific lipid species affected by plsY activity

    • Correlate lipid composition with magnetite crystal nucleation and growth

  • Protein-protein interaction mapping:

    • Identify potential interaction partners of plsY within the magnetosome formation pathway

    • Use pull-down assays combined with mass spectrometry

    • Verify interactions with techniques like FRET or split-GFP complementation

  • Localization studies:

    • Create fluorescently tagged plsY to visualize subcellular distribution

    • Use super-resolution microscopy to determine if plsY localizes to nascent magnetosomes

    • Correlate plsY localization with other magnetosome proteins

How does environmental magnetism influence plsY activity in M. magneticum?

Drawing from research on M. magneticum's magnetic properties , several experimental approaches can investigate environmental impacts:

  • Enzyme activity under magnetic fields:

    • Measure plsY kinetic parameters in the presence/absence of magnetic fields

    • Test whether field strength correlates with altered substrate specificity

    • Investigate potential conformational changes using structural methods

  • Expression analysis:

    • Compare plsY expression levels when growing M. magneticum with/without magnetic fields

    • Assess co-regulation with other magnetosome-related genes

    • Determine if post-translational modifications change under different magnetic conditions

  • Growth media effects:

    • Similar to how different media affects magnetic properties , test if media composition alters plsY activity

    • Specifically investigate the effects of transition metal ions on enzyme function

    • Correlate changes in plsY activity with magnetosome formation efficiency

  • Temperature-dependent studies:

    • Examine how temperature transitions (particularly around the Verwey transition at ~105K observed in magnetosomes) affect enzyme function

    • Relate findings to magnetic hyperthermia applications where M. magneticum has shown promise

How does plsY from M. magneticum compare with homologous enzymes from non-magnetotactic bacteria?

Comparative analysis provides insights into magnetotactic bacteria specialization:

  • Sequence and structural analysis:

FeatureAnalysis ApproachExpected Insights
Sequence conservationMultiple sequence alignmentMagnetotactic-specific motifs
Active site compositionHomology modelingSubstrate specificity determinants
Membrane interaction domainsHydrophobicity analysisSpecialized membrane localization
Regulatory elementsPromoter and UTR comparisonEnvironmental response differences
  • Biochemical comparison:

    • Compare substrate preferences between plsY from M. magneticum and non-magnetic species

    • Measure kinetic parameters under identical conditions

    • Test cross-species complementation in deletion strains

  • Evolutionary implications:

    • Phylogenetic analysis of plsY across bacterial lineages

    • Correlation with magnetosome gene cluster acquisition

    • Evidence for horizontal gene transfer or convergent evolution

What are promising strategies for improving recombinant M. magneticum plsY yields for structural studies?

High-resolution structural characterization requires milligram quantities of pure, homogeneous protein:

  • Advanced expression systems:

    • Cell-free expression systems with supplied phospholipids

    • Specialized E. coli strains with altered membrane composition

    • Consideration of alternative hosts like Bacillus or yeast expression systems

  • Synthetic biology approaches:

    • Design minimal plsY constructs retaining full activity

    • Engineer stabilizing mutations based on computational design

    • Create chimeric proteins with well-expressing homologs

  • Crystallization aids:

    • Antibody fragment co-crystallization to stabilize flexible regions

    • Lipidic cubic phase methods specifically designed for membrane proteins

    • Nanobody selection for conformational stabilization

How might plsY function be leveraged for biotechnological applications?

The acyltransferase activity of plsY offers several potential biotechnological applications:

  • Biocatalysis applications:

    • Production of specialized phospholipids with defined acyl chain compositions

    • Synthesis of lipid anchors for protein modifications

    • Generation of structured lipids for nutritional applications

  • Magnetosome engineering:

    • Controlling magnetosome size and properties through modulation of membrane composition

    • Creating functionalized magnetic nanoparticles with specific surface characteristics

    • Engineering bacteria for enhanced magnetic hyperthermia applications

  • Membrane technology:

    • Developing biomimetic membranes with specific lipid compositions

    • Creating model systems for studying membrane protein functions

    • Designing lipid nanoparticles with controlled properties for drug delivery

What computational approaches can predict plsY structure-function relationships?

Integrating experimental data with computational methods offers powerful insights:

  • Advanced modeling approaches:

    • Molecular dynamics simulations of plsY in membrane environments

    • Substrate docking and molecular mechanics to understand binding specificity

    • Quantum mechanical methods to investigate catalytic mechanism

  • Machine learning applications:

    • Sequence-based prediction of critical functional residues

    • Activity prediction based on structural features

    • Design algorithm application (e.g., PROSS) for stability enhancement

  • Network analysis:

    • Modeling plsY within the context of phospholipid metabolism

    • Systems biology approaches to understand magnetosome formation

    • Predicting effects of environmental parameters on enzymatic performance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.