Recombinant Magnetospirillum magneticum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please contact us in advance for arrangements. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To facilitate long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
lgt; amb0595; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Target Names
lgt
Target Protein Sequence
MTFALAYPHIDPIALQIGPIAIRWYALAYIAGLMLGWRYVKFLVARPPNAMTELEVDDFL VWATMGVVLGGRLGYVLFYKPLYYLENPLEIPMVWQGGMSFHGGALGVIVGIIAFSRFRG RNLFQVGDVICCAVPIGLFFGRIANFVNGELFGRVAPDVDWAMVFPGGGPLPRHPSQLYE AGLEGAVLFLVLFGLWRLTGIRHRAGALSGVFLAGYGLARIASEFFRQPDAHLGFLWGGA TMGQLLSIPQVLVGLALLAWALRRGAKAA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: mag:amb0595

STRING: 342108.amb0595

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Lgt function contribute to the unique physiology of magnetotactic bacteria?

Magnetotactic bacteria (MTB) like M. magneticum produce iron-based intracellular magnetic crystals within membrane-enclosed vesicles called magnetosomes . While not directly established in the literature, Lgt likely participates in maintaining the specialized membrane architecture required for magnetosome formation. The enzyme's role in proper lipoprotein processing may be essential for:

  • Maintaining outer membrane integrity during iron transport

  • Processing magnetosome-associated membrane proteins

  • Facilitating proper cellular response to magnetic fields

  • Supporting the complex redox environment required for biomineralization

The interaction between Lgt-processed lipoproteins and the magnetosome formation machinery would represent an important intersection between fundamental bacterial physiology and the specialized magnetic sensing apparatus.

What genomic context surrounds the lgt gene in M. magneticum?

While specific genomic data for lgt in M. magneticum is not explicitly provided in the search results, comparative analysis with related bacteria suggests that the lgt gene likely exists outside the magnetosome island (MAI). The MAI in Magnetospirillum contains operons like mamAB, mamGFDC, mms6, and mamXY, which are directly involved in magnetosome formation . The lgt gene, being fundamental to general bacterial physiology, would likely be part of the core genome rather than the specialized MAI region. Understanding the genomic context of lgt in M. magneticum would require genome sequencing and comparative analysis with other Magnetospirillum species, such as M. gryphiswaldense MSR-1, which has had its complete genome sequenced .

What expression systems are most effective for producing recombinant M. magneticum Lgt?

Based on experimental approaches with similar bacterial proteins, the following expression systems would be most appropriate for recombinant M. magneticum Lgt:

For optimal results, heterologous expression should include fusion tags for purification (His6 or Strep-tag II) and leverage approaches similar to those used for expressing fully heme-loaded MamP from AMB-1 . Expression conditions must be carefully optimized to maintain enzyme activity, as Lgt is a membrane protein with multiple transmembrane domains.

What biochemical assays can assess recombinant M. magneticum Lgt activity?

Several methods can be employed to evaluate the enzymatic activity of recombinant Lgt:

  • In vitro diacylglyceryl transferase assay: Using fluorescently or radiolabeled phosphatidylglycerol substrates and synthetic prolipoprotein acceptors to monitor transfer activity.

  • Mass spectrometry-based analysis: Detecting the addition of diacylglyceryl moieties to substrate proteins using LC-MS/MS approaches.

  • Complementation assays: Testing the ability of recombinant Lgt to rescue Lgt-depleted bacterial strains, which could show restoration of outer membrane integrity .

  • Inhibitor screening: Evaluating potential inhibitors using techniques established for E. coli Lgt, where inhibitors potently block biochemical activity in vitro and show bactericidal effects .

  • Protein-substrate interaction assays: Surface plasmon resonance or isothermal titration calorimetry to study binding kinetics with substrate lipoproteins and phospholipids.

These assays should be validated using positive controls such as known active Lgt enzymes from related species and negative controls including catalytically inactive Lgt mutants.

How can researchers overcome challenges in purifying functional recombinant Lgt?

Purification of functional membrane-associated enzymes like Lgt presents several challenges. A methodical approach includes:

  • Optimal detergent selection: Screen detergents like DDM, LDAO, or CHAPS that maintain native enzyme conformation while extracting from membranes.

  • Lipid supplementation: Addition of specific phospholipids during purification to maintain enzyme stability and activity.

  • Temperature control: Maintaining low temperatures (4°C) throughout purification to prevent denaturation.

  • Limited proteolysis control: Addition of appropriate protease inhibitors to prevent degradation.

  • Reconstitution strategies: For highest activity, reconstitute purified enzyme into liposomes or nanodiscs with lipid compositions mimicking the M. magneticum membrane environment.

  • Activity preservation: Include stabilizing agents like glycerol (10-15%) in storage buffers and avoid freeze-thaw cycles by flash-freezing aliquots in liquid nitrogen.

Researchers should validate enzyme function at each purification step using the biochemical assays described previously to ensure retention of catalytic activity.

Does Lgt activity influence magnetosome biogenesis in M. magneticum?

While direct experimental evidence linking Lgt to magnetosome formation is not explicitly provided in the search results, several indirect connections can be inferred:

  • Membrane integrity: Proper Lgt function is crucial for outer membrane stability, and disruption of membrane architecture could potentially affect the specialized membrane invaginations required for magnetosome formation.

  • Protein processing: Magnetosome-associated proteins may include lipoproteins requiring Lgt-mediated processing for proper localization and function.

  • Iron transport and accumulation: Studies show that magnetotactic bacteria accumulate large pools of iron for magnetosome formation . Lgt-processed lipoproteins may participate in iron transport systems or maintenance of proper redox environments for biomineralization.

  • Interaction with MAI proteins: Proteins encoded within the magnetosome island, particularly those with membrane associations, might interact with Lgt-processed lipoproteins to facilitate proper magnetosome assembly.

To definitively establish the relationship between Lgt and magnetosome formation, conditional knockdown or depletion studies of Lgt in M. magneticum would be necessary, followed by analysis of magnetosome number, morphology, and magnetic properties.

How do redox conditions affect recombinant M. magneticum Lgt activity in relation to magnetosome formation?

Redox conditions likely play a significant role in Lgt activity and magnetosome formation, based on what we know about magnetotactic bacteria:

  • Redox-sensitive biomineralization: Magnetosome formation involves controlled redox chemistry. Proteins like MamP and MamT in M. magneticum contain essential c-type cytochrome redox sites critical for iron biomineralization .

  • Redox potential considerations: The Fe(III)-Fe(II) redox couple of MamP is set at an unusual potential (-89 ± 11 mV) compared to other cytochromes involved in iron transformations . This suggests that the magnetosome environment maintains specific redox conditions that could affect Lgt activity.

  • Experimental approach: When studying recombinant Lgt, researchers should establish controlled redox conditions that mimic those found in M. magneticum cells:

    • Buffer systems with defined redox potentials

    • Addition of reducing agents (DTT, β-mercaptoethanol) at appropriate concentrations

    • Monitoring oxygen levels during enzyme reactions

    • Testing activity under microaerobic conditions similar to those used for M. magneticum cultivation

Understanding the interplay between redox conditions, Lgt activity, and magnetosome formation would provide valuable insights into the complex regulatory networks governing this specialized bacterial process.

How does M. magneticum Lgt differ structurally and functionally from Lgt in E. coli and other well-studied bacteria?

Based on current understanding of bacterial Lgt enzymes, we can infer the following comparative characteristics:

FeatureE. coli LgtPredicted M. magneticum LgtSignificance
Substrate specificityProcesses numerous lipoproteinsPotentially adapted for magnetosome-associated lipoproteinsMay reflect specialized function in magnetotactic bacteria
Membrane localizationInner membraneLikely inner membraneConsistent with role in initial lipoprotein processing
Inhibitor sensitivitySensitive to identified Lgt inhibitors Unknown, potentially similar sensitivityCould provide research and therapeutic targets
Interaction partnersWell-characterized lipoprotein processing machineryMay include magnetosome-specific proteinsMight reveal novel protein interactions
EssentialityEssential in most conditionsLikely essential based on E. coli data Important target for understanding core metabolism

Direct experimental comparison would require cloning, expression, and biochemical characterization of M. magneticum Lgt alongside E. coli Lgt under identical conditions. Crystallographic studies would also reveal structural differences that might explain any functional distinctions.

What insights can be gained from studying deletion mutants of lgt in M. magneticum compared to other bacteria?

Studies in other bacteria, particularly E. coli, show that Lgt depletion leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics . Similar experiments in M. magneticum would likely reveal:

  • Cell envelope integrity: Assessment of membrane permeability using fluorescent dyes would demonstrate the importance of Lgt in maintaining envelope integrity in magnetotactic bacteria.

  • Magnetosome formation: Quantitative analysis of magnetosome number, size, and arrangement would reveal whether Lgt is essential for proper magnetic particle biomineralization.

  • Magnetic response: Examination of magnetic field sensing and swimming behavior would determine if Lgt-processed lipoproteins are involved in the unique motility reversal responses observed in M. magneticum .

  • Resistance mechanisms: Unlike other lipoprotein processing enzymes where deletion of the major outer membrane lipoprotein (lpp) provides resistance to inhibition, Lgt inhibition is not rescued by lpp deletion . This suggests that studying M. magneticum lgt mutants might reveal novel aspects of lipoprotein processing essential for cell viability.

  • Growth phenotypes: Conditional knockdown systems would allow characterization of growth defects in various media conditions, similar to the impaired growth observed in non-magnetic M. gryphiswaldense mutants .

These comparative analyses would contribute to our understanding of both general bacterial physiology and specialized magnetotactic bacterial processes.

How can recombinant M. magneticum Lgt be utilized in developing antimicrobial strategies?

Lgt represents a promising antibacterial target for several reasons:

  • Novel target space: The first Lgt inhibitors have been identified that potently inhibit Lgt biochemical activity in vitro and are bactericidal against wild-type A. baumannii and E. coli strains .

  • Resistance advantage: Unlike inhibitors targeting other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests a lower propensity for resistance development.

  • Research applications with recombinant M. magneticum Lgt:

    • High-throughput screening platforms using purified enzyme to identify novel inhibitor scaffolds

    • Structure-activity relationship studies to optimize inhibitor potency and selectivity

    • Crystallographic analysis of enzyme-inhibitor complexes to guide rational drug design

    • Development of whole-cell assays using M. magneticum to evaluate inhibitor uptake and efficacy

    • Comparative studies against Lgt from pathogenic species to assess spectrum of activity

  • Potential clinical significance: Inhibitors identified against M. magneticum Lgt could be developed into antimicrobials effective against difficult-to-treat Gram-negative infections, addressing the urgent need for new antibiotics.

What methodological approaches can investigate the relationship between Lgt function and magnetic field sensing in M. magneticum?

Several sophisticated methodological approaches can elucidate the connection between Lgt and magnetotaxis:

  • Conditional gene expression systems:

    • Develop inducible promoter systems for M. magneticum lgt

    • Create titratable expression systems to study partial Lgt depletion phenotypes

    • Monitor magnetic field response as Lgt levels decrease

  • Advanced microscopy techniques:

    • High-resolution TEM to visualize magnetosome formation during Lgt depletion

    • Correlative light and electron microscopy to link protein localization with ultrastructure

    • Super-resolution microscopy to track fluorescently tagged Lgt and magnetosome proteins

  • Microfluidic assay systems:

    • Design specialized chambers with controlled magnetic field gradients

    • Track single-cell responses during Lgt inhibition or depletion

    • Quantify the previously observed motility reversal behavior in magnetic field gradients

  • Proteomic approaches:

    • Comparative membrane proteomics between wild-type and Lgt-depleted cells

    • Identification of lipoproteins specifically affected by Lgt depletion

    • Analysis of magnetosome membrane protein composition following Lgt inhibition

  • Biophysical measurements:

    • Atomic force microscopy to assess changes in cell envelope stiffness

    • Magnetic tweezers to measure changes in cellular magnetic moment

    • SQUID magnetometry to quantify total cellular magnetization

These methodologies would provide comprehensive insights into how Lgt function influences the unique magnetic sensing capabilities of M. magneticum.

What are the implications of studying Lgt in understanding the evolution of magnetotaxis?

Studying Lgt in magnetotactic bacteria provides a unique opportunity to understand the evolution of magnetotaxis:

  • Fundamental vs. specialized processes: Lgt represents a fundamental bacterial process that likely predates the evolution of magnetotaxis. Understanding how this core enzyme may have been co-opted or modified for magnetosome formation offers insights into evolutionary innovation.

  • Comparative genomic approaches:

    • Analysis of lgt genes across diverse magnetotactic and non-magnetotactic bacteria

    • Identification of potential magnetotaxis-specific adaptations in Lgt sequence or regulation

    • Correlation with magnetosome island gene acquisition and evolution

  • Evolutionary significance of magnetosome islands:

    • The magnetosome island (MAI) in M. gryphiswaldense is remarkably rich in insertion elements and contains many genes specific to magnetotactic bacteria

    • Understanding how core processes like Lgt function interact with these specialized gene clusters can reveal evolutionary paths to complex cellular structures

  • Horizontal gene transfer considerations:

    • Frequent spontaneous loss of magnetic phenotype has been observed in stationary-phase cultures

    • Large chromosomal deletions (approximately 80 kb) can occur in the MAI region

    • Investigating whether Lgt or its regulation differs between spontaneous non-magnetic mutants and wild-type strains would provide insights into the evolutionary stability of magnetotaxis

  • Implications for astrobiology:

    • Magnetotactic bacteria represent ancient prokaryotic lineages

    • Understanding the relationship between fundamental cellular processes (Lgt) and specialized functions (magnetotaxis) may inform theories about early microbial evolution on Earth and potentially other planets

This research direction connects molecular microbiology with broader evolutionary questions about the origin and maintenance of complex bacterial traits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.