Recombinant Magnetospirillum magneticum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; amb3406; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Target Names
crcB
Target Protein Sequence
MLTYALVALGSAIGGTLRYWLSMVIAEASAGTFPWATLVINVAGSAAIGLFATLTSVDGR VFVPSEWRTFFMVGICGGFTTFSSFSLQTLALAQDGDWLAAGLNVVGSVALCLLAVWLGH VAATIINR
Uniprot No.

Target Background

Function
CrcB plays a crucial role in reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links

KEGG: mag:amb3406

STRING: 342108.amb3406

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the amino acid sequence of Magnetospirillum magneticum CrcB homolog protein?

The full amino acid sequence of the Magnetospirillum magneticum CrcB homolog protein is: mLTYALVALGSAIGGTLRYWLSMVIAEASAGTFPWATLVINVAGSAAIGLFATLTSVDGRVFVPSEWRTFFMVGICGGFTTFSSFSLQTLALAQDGDWLAAGLNVVGSVALCLLAVWLGHVAATIINR . The expression region is typically positions 1-128 of the full-length protein sequence .

What are the available identifiers and reference information for CrcB homolog research?

The CrcB homolog protein from Magnetospirillum magneticum has the following key identifiers:

  • Uniprot accession number: Q2W1R5

  • Gene name: crcB

  • Ordered locus name: amb3406

  • Host organism: Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

These identifiers are essential when searching databases, ordering materials, or citing the protein in publications.

What is known about the general function of CrcB homolog proteins in bacteria?

While the specific function of CrcB in M. magneticum is not fully characterized in the provided research, CrcB homologs are generally involved in ion transport across membranes in bacterial systems. Based on the protein sequence, which includes multiple transmembrane regions (indicated by the hydrophobic amino acid clusters), the CrcB homolog likely functions in membrane transport processes . Unlike MamJ and MamK proteins that are directly involved in magnetosome chain formation in magnetotactic bacteria, CrcB homologs typically play roles in cellular homeostasis and ion regulation, particularly fluoride ion efflux in many bacterial species.

What are the optimal conditions for storing recombinant CrcB homolog protein?

The recombinant CrcB homolog protein should be stored in Tris-based buffer with 50% glycerol at -20°C for regular use. For extended storage, it is recommended to store the protein at -80°C . To maintain protein stability and activity, researchers should avoid repeated freezing and thawing cycles. Working aliquots can be kept at 4°C for up to one week . The specific buffer composition (Tris concentration, pH, and any additional stabilizing agents) should be optimized based on experimental requirements.

What experimental approaches can be used to study CrcB protein interactions in Magnetospirillum magneticum?

Based on successful approaches used for studying other M. magneticum proteins, researchers can employ several techniques to investigate CrcB protein interactions:

  • Bacterial Two-Hybrid System: This approach has proven effective for screening protein-protein interactions in M. magneticum. Researchers can construct a two-hybrid DNA library by fusing random genomic fragments to the N-terminal domain of the α-subunit of RNA polymerase in a vector (such as pTRG), while cloning the crcB gene in frame with the λ repressor protein (λ cI) in a vector (such as pBT) .

  • Cross-Linking Analysis: To confirm protein interactions identified through screening, cross-linking experiments can be performed in vitro. This involves expressing and purifying the proteins of interest using systems such as the glutathione S-transferase gene fusion system, followed by cross-linking and analysis by SDS-PAGE .

  • Co-Immunoprecipitation: Though not explicitly mentioned in the search results, this is a standard technique for validating protein interactions that would be applicable to CrcB research.

How can researchers express and purify recombinant CrcB protein for functional studies?

For the expression and purification of recombinant CrcB protein:

  • Cloning Strategy: The crcB gene (amb3406) can be amplified from M. magneticum AMB-1 genomic DNA using PCR with appropriate primers containing restriction sites (such as EcoRI and BamHI) .

  • Expression Systems: Based on protocols used for other M. magneticum proteins, researchers can use E. coli-based expression systems with appropriate vectors containing affinity tags (such as GST or His-tag) .

  • Purification Protocol:

    • Use affinity chromatography based on the chosen tag

    • Include a buffer optimization step to maintain protein stability

    • Consider membrane protein solubilization strategies since CrcB likely contains transmembrane domains

    • Verify purity using SDS-PAGE and Western blotting

  • Functional Reconstitution: For functional studies, the purified protein may need to be reconstituted into liposomes or nanodiscs to maintain its native membrane environment.

How might CrcB interact with the magnetosome formation machinery in Magnetospirillum magneticum?

While direct evidence for CrcB involvement in magnetosome formation is not provided in the search results, researchers can investigate potential interactions based on known magnetosome-related processes:

  • Protein Interaction Screening: Using the bacterial two-hybrid system, researchers can test for interactions between CrcB and known magnetosome-associated proteins like MamJ, MamK, and MamA .

  • Localization Studies: Fluorescent tagging of CrcB can determine whether it colocalizes with magnetosome chains or membrane invaginations associated with magnetosome formation.

  • Functional Analysis: Gene deletion or mutation studies of crcB can assess its impact on magnetosome formation, organization, and function.

The protein interaction network identified for MamK includes several signal transduction-related proteins that are involved in chemotaxis . A similar approach could uncover whether CrcB participates in these or related pathways in M. magneticum.

What approaches can be used to investigate the potential role of CrcB in ion transport in Magnetospirillum magneticum?

To investigate ion transport functions of CrcB:

  • Electrophysiological Studies: Researchers can incorporate purified CrcB into artificial lipid bilayers or use patch-clamp techniques on bacterial spheroplasts to measure ion conductance.

  • Fluorescence-Based Assays: Using ion-sensitive fluorescent probes to monitor changes in ion concentrations in response to CrcB expression.

  • Radioactive Ion Flux Measurements: Tracking the movement of radioactively labeled ions across membranes in the presence and absence of functional CrcB.

  • Microbial Fuel Cell (MFC) Studies: Since M. magneticum has demonstrated electroactivity in MFC systems , researchers could investigate whether CrcB plays any role in electron transfer or ion movement that contributes to this electroactivity by comparing wild-type and crcB mutant strains.

Table 1: Suggested experimental design for investigating CrcB ion transport function

Experimental ApproachKey EquipmentMeasured ParametersControls
Patch-clampElectrophysiology rig, microelectrodesCurrent-voltage relationships, ion selectivityEmpty liposomes, inactive mutant
Fluorescence assaysFluorometer, ion-sensitive dyesIon concentration changes over timeCells without CrcB expression
Radioactive ion fluxScintillation counter, isotope tracersRate of ion transportTransport inhibitors
MFC analysisH-shaped MFCs with carbon brush anodesCurrent generation, polarization curvesCrcB knockout strains

How can researchers differentiate the functions of CrcB from other membrane proteins in Magnetospirillum magneticum?

To differentiate CrcB functions from other membrane proteins:

  • Gene Deletion and Complementation: Generate crcB knockout mutants and assess phenotypic changes. Complement with wild-type or mutated crcB to confirm function specificity .

  • Domain Swapping Experiments: Create chimeric proteins by swapping domains between CrcB and other membrane proteins to identify functional domains.

  • Site-Directed Mutagenesis: Introduce specific mutations in conserved residues to determine their importance for function.

  • Comparative Genomics: Analyze the presence and conservation of crcB across different magnetotactic bacteria strains and correlate with phenotypic differences.

  • Transcriptomics and Proteomics: Analyze changes in gene expression and protein levels in response to conditions that might affect CrcB function (such as ion stress or magnetic field changes).

How might CrcB homolog function relate to the unique magnetotaxis behavior of Magnetospirillum magneticum?

The relationship between CrcB and magnetotaxis could be investigated through several approaches:

  • Behavioral Assays: Compare the magnetotactic behavior of wild-type and crcB mutant strains using magnetic field response assays.

  • Protein Interaction Network Analysis: Investigate whether CrcB interacts with proteins involved in magnetotaxis, similar to the interaction network established for MamK with chemotaxis and flagellar proteins .

  • Ion Homeostasis and Magnetosome Formation: Since magnetosome formation involves iron uptake and biomineralization, CrcB's potential role in ion transport might indirectly affect this process.

The research on MamK has shown interactions with flagella motor-associated proteins (Amb1699, Amb1700, and Amb3498) and chemotaxis proteins , suggesting a link between magnetosome organization and bacterial motility. A similar investigation for CrcB might reveal connections to these systems.

What are the most effective imaging techniques for studying CrcB localization in Magnetospirillum magneticum cells?

For studying CrcB localization:

  • Fluorescent Protein Fusion: Creating GFP-CrcB fusion proteins for live-cell imaging, similar to approaches used for MamK-GFP which revealed its filamentous structure along the cell's inner curvature .

  • Immunogold Electron Microscopy: Using antibodies against CrcB coupled with gold nanoparticles for high-resolution localization in relation to magnetosomes and other cellular structures.

  • Super-Resolution Microscopy: Techniques such as STORM or PALM can provide nanometer-scale resolution of protein localization while preserving cellular context.

  • Correlative Light and Electron Microscopy (CLEM): Combining fluorescence microscopy with electron microscopy to correlate CrcB localization with ultrastructural features of magnetosomes.

How can electrochemical techniques be applied to study CrcB function in Magnetospirillum magneticum?

Given the electroactivity demonstrated by M. magneticum in microbial fuel cells , electrochemical techniques offer promising approaches to study CrcB:

  • Microbial Fuel Cell Analysis: Compare the electrochemical activity of wild-type and crcB mutant strains in H-shaped MFCs with carbon brush anodes and platinum-coated titanium mesh cathodes .

  • Cyclic Voltammetry: Measure the redox properties of purified CrcB or CrcB-expressing bacteria to identify potential electron transfer capabilities.

  • Electrochemical Impedance Spectroscopy: Analyze changes in membrane properties and ion transport in the presence and absence of CrcB expression.

  • Biofilm Formation on Electrodes: Investigate whether CrcB affects the ability of M. magneticum to form electroactive biofilms on electrode surfaces.

Table 2: Electrochemical parameters for CrcB functional studies in MFCs

ParameterMeasurement MethodTypical Values for M. magneticumSignificance
Current densityAmmeter connected to MFCVariable based on conditionsIndicates electron transfer capacity
Internal resistancePolarization curve analysisSystem-dependentReflects efficiency of electron transfer
Coulombic efficiencyCalculation based on substrate consumptionSystem-dependentMeasures conversion of substrate to electricity
Open circuit voltageVoltmeter with high impedance0.3-0.8 V (typical range)Maximum theoretical voltage of the system

What are the most promising approaches for determining the 3D structure of CrcB homolog protein?

For determining the 3D structure of CrcB:

  • X-ray Crystallography: Though challenging for membrane proteins, this remains the gold standard for high-resolution protein structures. Requires optimization of crystallization conditions for membrane proteins, possibly using detergents or lipidic cubic phases.

  • Cryo-Electron Microscopy: Particularly suitable for membrane proteins that resist crystallization. Recent advances have enabled near-atomic resolution structures.

  • NMR Spectroscopy: Useful for studying protein dynamics and ligand interactions, though size limitations may require analysis of specific domains rather than the full protein.

  • Computational Modeling: Homology modeling based on related proteins with known structures, combined with molecular dynamics simulations to predict functional states.

How might studying CrcB contribute to understanding the evolution of magnetotaxis in bacteria?

Investigating CrcB in an evolutionary context could involve:

  • Comparative Genomics: Analyze the distribution and conservation of crcB genes across magnetotactic and non-magnetotactic bacteria to identify patterns of coevolution with magnetosome genes.

  • Phylogenetic Analysis: Construct evolutionary trees of CrcB homologs to determine whether their evolution parallels that of magnetosome formation proteins.

  • Horizontal Gene Transfer Analysis: Investigate whether crcB genes, like magnetosome genes, might have been transferred horizontally between bacterial species.

  • Functional Conservation Testing: Express CrcB homologs from different species in M. magneticum to test functional conservation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.