Recombinant Maize streak virus genotype A Movement protein (V2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Maize Streak Virus Genotype A Movement Protein (V2)

The recombinant Maize streak virus genotype A movement protein (V2) is a laboratory-engineered version of the viral protein responsible for facilitating systemic infection in plants. Derived from the maize-adapted strain MSV-A, this protein is expressed in Escherichia coli with an N-terminal histidine (His) tag for purification and structural studies. Its research significance lies in understanding virus-cell interactions, recombination dynamics, and developing resistance strategies against maize streak disease (MSD), a major crop threat in Africa .

Functional Interactions

V2 interacts with the MSV-A coat protein (CP) to mediate cell-to-cell movement:

  1. CP Binding: Forms a complex with CP to divert viral DNA from nuclear replication sites to the cell periphery .

  2. Movement Mechanism: Prevents nuclear transport of CP-DNA complexes in microinjected cells, enabling systemic spread .

  3. Recombination Hotspots: The v2-cp interface is a conserved recombination hotspot across geminiviruses, linked to MSV-A’s emergence as a maize pathogen .

Production Methods

Three recombinant V2 variants have been characterized:

ParameterMSV-A (South Africa) MSV-A (Kenya) MSV-A (Unspecified)
UniProt IDP14992P0C648Q91MG4
AA SequenceMD...TG (101aa)MD...TG (101aa)MD...TG (101aa)
SourceE. coliE. coliE. coli
TagN-terminal HisN-terminal HisN-terminal His
Storage BufferTris/PBS + 6% trehalose (pH 8.0)Tris/PBS + 6% trehalose (pH 8.0)Tris/PBS + 6% trehalose (pH 8.0)

Research Applications

  1. Functional Studies:

    • V2-CP Complex Analysis: Used to study virus movement dynamics via co-immunoprecipitation and gel overlay assays .

    • Recombination Modeling: Artificial chimeras with MSV-B have elucidated recombination breakpoints at the v2-cp interface, critical for MSV-A’s adaptability .

  2. Diagnostic Tools:

    • SDS-PAGE Validation: Confirmed protein integrity and purity in recombinant preparations .

  3. Resistance Development:

    • Inducible Resistance Systems: While not directly targeting V2, studies on MSV-A’s rep gene highlight strategies to disrupt viral replication, indirectly affecting V2’s role .

Recombination Origins

MSV-A’s v2 gene originated from ancestral recombination between MSV-B (virion-sense ORFs) and MSV-G/F (complement-sense ORFs) . This event likely enhanced MSV-A’s ability to infect multiple grass species and maize, explaining its rapid spread across Africa .

Geographical Dispersal

  • MSV-A Subtypes:

    SubtypeGeographical RangeEmergence Timeline
    MSV-A₁Pan-AfricanPre-19th century
    MSV-A₂West AfricaMid-20th century
    MSV-A₄Southern AfricaLate 20th century
    MSV-A₆La Réunion20th century

Data synthesized from phylogeographic analyses .

Host Specificity

V2’s structural divergence enables MSV-A to infect maize more efficiently than other MSV strains. For example:

  • MSV-A vs. MSV-B: MSV-A recombinants exhibit higher virulence in maize due to optimized V2-CP interactions .

  • Host Range: MSV-A infects 40+ grass species, broadening its ecological niche compared to grass-adapted strains .

Challenges and Future Directions

  1. Structural Elucidation:

    • Cryo-EM/X-ray Studies: Needed to resolve V2’s tertiary structure and binding interfaces with CP.

  2. Resistance Mechanisms:

    • CRISPR-based Editing: Targeting V2’s recombination hotspots to disrupt MSV-A mobility.

  3. Epidemiological Monitoring:

    • Subtype Tracking: Tracing MSV-A recombinants (e.g., MSV-A₁VII) to predict disease outbreaks .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
V2; Movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Maize streak virus genotype A (isolate Kenya) (MSV)
Target Names
V2
Target Protein Sequence
MDPQNALYYQPRVPTAAPTSGGVPWSRVGEVAILSFVALICFYLLYLWVLRDLILVLKAR QGRSTEELIFGGQAVDRSNPIPNIPAPPSQGNPGPFVPGTG
Uniprot No.

Target Background

Function
Plays a role in viral transport within and between cells.
Protein Families
Mastrevirus movement protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the evolutionary origin of MSV-A and what role did the movement protein play in its emergence?

    MSV-A, the maize-adapted strain causing maize streak disease throughout sub-Saharan Africa, likely emerged between 100 and 200 years ago through homologous recombination between two MSV strains adapted to wild grasses . This critical evolutionary event involved the exchange of the movement protein-coat protein gene cassette . The recombination breakpoints were not random but occurred in genomic regions most prone to recombination in mastrevirus genomes: the first surrounding the virion-strand origin of replication, and the second around the interface between the coat protein gene and the short intergenic region . This suggests that the acquisition of the specific movement protein variant through recombination was instrumental in the adaptation of MSV to maize as a host.

  • How can researchers experimentally study MSV recombination and the role of the movement protein?

    Researchers can employ a system using pairs of laboratory-constructed reciprocal chimaeric MSV genomes derived from different strains (e.g., grass-adapted MSV-B and maize-adapted MSV-A) . These chimaeric constructs collectively contain the complete genomic sequence of a maize-adapted MSV isolate. When co-introduced into host plants, these defective parental viruses can recombine, potentially regenerating genomes that approximate the wild-type MSV-A . By analyzing which recombinant progeny become dominant in the population and mapping their recombination breakpoints, researchers can identify which gene segments (including the movement protein) contribute most significantly to host adaptation .

  • What methodologies are available for measuring the impact of movement protein variants on MSV symptomatology?

    Researchers can quantify four primary infection symptom types: chlorotic areas, intensities of chlorosis, leaf deformation, and leaf stunting . For each measurement, leaves four, five, and six from each maize seedling should be harvested at 21, 28, and 35 days post-inoculation, respectively . The second quarter from the base of each leaf can be used for automated symptom quantification by image analysis . This approach has been shown to correlate with the five-point scale widely used by breeders for visually rating MSV symptom severity in field conditions . When comparing different movement protein variants, researchers should use multiple maize genotypes with differential resistance levels to assess genotype-specific effects.

  • How should experiments be designed to assess virus×host interactions when studying movement protein variants?

    Experiments should include:

    • Multiple maize genotypes with varying resistance levels (e.g., highly susceptible, moderately resistant, and highly resistant lines)

    • Carefully controlled inoculation methods (such as R. radiobacter-mediated delivery of infectious constructs)

    • Regular assessment intervals (typically weekly) after inoculation

    • Standardized scoring systems (typically 1-9 scale adjusted by image analysis)

    • Uninfected controls to serve as leaf size standards for measuring stunting

    • Sufficient replication (36-72 plants per virus-host combination across 3-5 independent experiments)

    • Consistent growing conditions (e.g., 16-hour light cycles at 20-25°C)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.