Recombinant Maize streak virus genotype C Movement protein (V2)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

The Recombinant Maize streak virus genotype C Movement protein (V2) is a bioengineered protein derived from the movement protein (MP) gene of Maize streak virus (MSV) genotype C (isolate Set). Expressed in E. coli with an N-terminal His tag, this recombinant protein is purified to >90% homogeneity and used primarily in virological and molecular biology research .

Protein Properties

ParameterValue
LengthFull-length (1–101 amino acids)
TagN-terminal His tag
SequenceMDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKARRGRSTEELIFGSEAVDRRHPIPNTLEPTAPVHPGPFVPGQG
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage

Key Features:

  • Function: Facilitates viral cell-to-cell movement by interacting with the coat protein (CP) to divert the CP-DNA complex from the nucleus to the cell periphery .

  • Host Origin: Derived from Maize streak virus genotype C (MSV-C), a pathogen with a narrow host range compared to maize-adapted strains like MSV-A .

Role in Viral Pathogenesis

The V2 protein (MP) plays a critical role in systemic infection:

  1. MP-CP Interaction: Binds to the coat protein (CP), forming a complex that prevents nuclear transport of viral DNA, enabling cell-to-cell spread .

  2. Host Adaptation: Recombination events in the mp gene region contribute to host specificity. MSV-C isolates, such as MSV-Set, exhibit limited host range, contrasting with maize-adapted MSV-A strains .

  3. Symptom Modulation: Variations in mp sequences correlate with symptom severity. MSV-C typically induces milder symptoms compared to MSV-A, though recombination can alter pathogenicity .

Production Process

StepDetails
Expression SystemE. coli transformed with plasmid encoding MSV-C V2 gene
PurificationAffinity chromatography (His tag) + SDS-PAGE validation
StabilityLyophilized powder; avoid repeated freeze-thaw cycles

Applications:

  • Antibody Development: Serves as an antigen for generating polyclonal antibodies (e.g., rabbit anti-V2) .

  • Functional Studies: Used in assays to study MP-CP interactions, nuclear export mechanisms, and host-specific movement .

  • Recombination Studies: Analyzed to map breakpoints in mastrevirus genomes, particularly at recombination hotspots near the cp/movement protein interface .

Genomic and Evolutionary Insights

  • Recombination Hotspots: MSV-C V2 sequences are hotspots for recombination, particularly at the cp/SIR interface and virion-strand origin of replication (v-ori). This mirrors patterns in begomoviruses, suggesting conserved mechanisms in viral evolution .

  • Host-Specific Adaptation: MSV-C’s V2 region shows reduced sequence identity with maize-adapted strains (e.g., ~80% vs. MSV-A), contributing to its limited host range .

Experimental Data

ParameterMSV-C V2MSV-A V2Significance
Host RangeNarrow (e.g., Setaria)Broad (maize)Reflects adaptation via V2 recombination
Symptom SeverityMildSevereCorrelates with V2 sequence divergence
Recombination RateHighHighDrives genomic diversity in MSV populations

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order and we will fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate it to us and we will prioritize its development.
Synonyms
V2; Movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Maize streak virus genotype C (isolate Set) (MSV)
Target Names
V2
Target Protein Sequence
MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLEPTAPVHPGPFVPGQG
Uniprot No.

Target Background

Function
Plays a crucial role in the movement of the virus within and between cells.
Protein Families
Mastrevirus movement protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What known functions does the Movement protein (V2) serve in the MSV infection cycle?

The movement protein (mp) of MSV, also referred to as V2, plays a critical role in cell-to-cell movement of the virus within the host plant. Research indicates that the mp functions as part of a gene cassette with the coat protein (cp), and this functional unit has been a focal point in recombination studies . Experimental approaches have demonstrated that recombination events involving the mp-cp gene cassette are particularly significant in the adaptation process of MSV to new hosts, suggesting this protein complex mediates critical virus-host interactions . The mp is essential for virus mobility through plasmodesmata, which enables systemic infection following initial replication.

What experimental systems are available for studying MSV recombination involving movement proteins?

Researchers have developed several experimental systems for studying MSV recombination. A particularly effective approach involves co-infecting plants with defective, laboratory-constructed MSV chimaeras that collectively contain the complete genomic sequence of a maize-adapted MSV isolate . For instance, researchers have used reciprocal chimaeras of wt MSV isolates (one adapted to wild grasses and another to maize) to track recombination:

Input virusesMaize genotypeParental virusRecombinant virusSimple recombinantsComplex recombinants
MatMPCPVW + VWMPCPMatMSV-sensitive3% (1), MatMPCPVW21% (7), VWMPCPMat77% (26)85%
MSV-resistant00100% (1)75%25%
MatMPCPLIRVW + VWMPCPLIRMatMSV-sensitive045% (18), VWMPCPLIRMat55% (22)95%
MSV-resistant07% (1), VWMPCPLIRMat93% (14)79%21%
MatMPCPVW + VWMPCPMatMSV-resistant8% (1), MatMPCPVW42% (5), VWMPCPMat100% (11)73%

This system allows researchers to observe how recombination can recreate relatively high-fitness genomes approximating the fittest wild-type genomes .

What recombination hotspots have been identified in the MSV genome, particularly around the movement protein gene?

Recombination in MSV occurs non-randomly with two primary hotspots identified: the first surrounding the virion-strand origin of replication, and the second around the interface between the coat protein gene and the short intergenic region . Analysis of natural and experimental recombination patterns demonstrates that these breakpoints appear to be largely predetermined by underlying mechanisms of mastrevirus recombination . When studying the movement protein specifically, researchers should focus on these recombination hotspots, as they appear to be evolutionarily conserved. The breakpoint distributions detected in MSV partially mirror those seen in begomoviruses, suggesting the forces shaping these patterns have been conserved since the earliest geminivirus ancestors .

How can researchers effectively construct and evaluate recombinant MSV genomes to study movement protein function?

To construct and evaluate recombinant MSV genomes for studying movement protein function, researchers should follow this methodological approach:

  • Design reciprocal chimaeras by exchanging the movement protein gene between MSV isolates with different host adaptations (e.g., between maize-adapted and grass-adapted isolates) .

  • Utilize agroinfection techniques for inoculating plants with the constructed chimaeras, potentially co-inoculating with complementary chimaeras .

  • Monitor symptom development over 60 days post-infection (dpi) across plants with varying resistance levels to assess fitness impacts .

  • Isolate and sequence viral genomes from symptomatic plants to identify recombination events that have occurred during infection .

  • Optionally, use leafhopper transmission to secondary plants to evaluate transmission efficiency of recombinant viruses .

  • Quantify symptoms using standardized metrics such as chlorotic area percentages, intensity of chlorosis, leaf deformation, and stunting .

This approach allows researchers to assess how specific movement protein variants affect viral fitness, host adaptation, and symptom development.

What evidence exists for the evolutionary history of MSV-C movement protein and its relationship to other genotypes?

Phylogeographical analysis of MSVs found in uncultivated indigenous African grasses has revealed a complex evolutionary history . While the search results don't provide specific details about MSV-C movement protein evolution, they do indicate that the ancestor of all MSV-A variants was likely the recombinant progeny of ancestral MSV-B and MSV-G/-F variants . This suggests that examining the evolutionary relationships between movement proteins of different MSV strains could provide insights into host adaptation mechanisms and possibly identify the genetic components that enable MSV-A's successful adaptation to maize.

When studying MSV-C movement protein evolution, researchers should apply similar phylogenetic approaches to those used in broader MSV evolution studies, focusing particularly on:

  • Sequence comparisons between movement proteins of different MSV strains

  • Identification of selection pressures acting specifically on the movement protein

  • Analysis of recombination events involving movement protein sequences

How do mutations in the movement protein correlate with changes in MSV symptomatology and fitness?

Research on MSV symptom evolution provides insights into how viral proteins, including movement proteins, influence host-pathogen interactions. Studies examining MSV evolution over approximately 110 years demonstrate a trade-off between transmission efficiency and host damage . While the movement protein wasn't specifically isolated in these studies, the findings suggest that MSV has evolved to increase the proportion of photosynthesizing leaf cells it infects while reducing chloroplast destruction within those cells .

To study how movement protein mutations specifically affect symptomatology, researchers should:

  • Generate movement protein variants through site-directed mutagenesis or by identifying natural variants.

  • Introduce these variants into infectious clones and inoculate differentially resistant maize genotypes.

  • Quantify symptom parameters including:

    • Chlorotic area percentages

    • Intensity of chlorosis

    • Leaf deformation

    • Leaf stunting

  • Compare these measurements across virus variants and host genotypes to isolate the effects of specific movement protein changes.

This approach can help determine how movement protein mutations influence both viral fitness and symptom expression.

What methodological approaches are most effective for studying MSV movement protein interactions with host factors?

To study interactions between MSV movement protein and host factors, researchers should employ a multi-faceted approach:

  • Yeast two-hybrid screening: Identify potential host protein interactions with the movement protein.

  • Bimolecular fluorescence complementation (BiFC): Verify protein-protein interactions in planta.

  • Immunoprecipitation followed by mass spectrometry: Identify host proteins that co-purify with the movement protein during infection.

  • Virus-induced gene silencing (VIGS): Knock down expression of candidate host interactors to assess their functional relevance to movement protein activity.

  • Subcellular localization studies: Track movement protein localization in different host backgrounds using fluorescent protein fusions.

  • Comparative studies across host species: Test movement protein function in both susceptible and resistant hosts to identify host factors that may restrict or facilitate movement protein function.

These approaches can help uncover how the movement protein interacts with host machinery and potentially identify targets for resistance breeding or antiviral strategies.

What statistical methods are appropriate for analyzing recombination patterns in MSV movement protein sequences?

When analyzing recombination patterns involving the MSV movement protein, researchers should employ robust statistical methods similar to those used in broader MSV recombination studies:

These statistical approaches provide rigorous frameworks for identifying and characterizing recombination events involving the movement protein.

How do MSV evolution rates inform our understanding of movement protein adaptation?

Studies indicate that single-stranded DNA viruses like MSV evolve at rates of approximately 10^-4 substitutions per site per year, which is surprisingly high given that their replication involves host DNA polymerases with much higher fidelities than error-prone viral RNA polymerases . This rapid evolution rate has significant implications for movement protein adaptation:

  • It enables rapid exploration of sequence space, potentially allowing the movement protein to adapt quickly to new hosts or changing conditions.

  • The high mutation rate may facilitate the fine-tuning of movement protein interactions with host factors across different grass species.

  • When combined with recombination, this mutation rate could generate novel movement protein variants with altered functionality, potentially enabling host jumps or resistance breaking.

Researchers studying MSV-C movement protein should consider these evolutionary dynamics when interpreting sequence variation and functional differences between isolates.

How can knowledge of MSV movement protein function be applied to developing resistance strategies?

Understanding the MSV movement protein's function and evolution can inform resistance breeding strategies:

  • Identification of host factors: By identifying host proteins that interact with the movement protein, researchers can potentially target these for modification to disrupt viral movement.

  • Resistance gene deployment: Knowledge of movement protein variation across MSV strains can help predict the durability of resistance and guide deployment strategies.

  • Transgenic approaches: Expression of modified movement proteins or antibodies targeting them could potentially interfere with viral movement.

  • Predictive modeling: Understanding recombination patterns involving the movement protein can help predict potential adaptation routes and inform preemptive resistance strategies.

Studies have shown that MSV resistance in maize affects recombination outcomes, with resistant varieties showing higher proportions of complex recombinants . This suggests that host resistance factors may interact with viral recombination mechanisms, providing another potential avenue for resistance development.

What are the key considerations when designing experiments to study MSV-C movement protein in different host backgrounds?

When designing experiments to study MSV-C movement protein in different host backgrounds, researchers should consider:

  • Host genotype selection: Include both susceptible and resistant genotypes, as viral behavior can differ significantly between them. For example, studies have shown different recombination patterns in MSV-sensitive versus MSV-resistant maize genotypes .

  • Environmental conditions: Maintain consistent growth conditions, as temperature and light can affect symptom expression and potentially movement protein function.

  • Temporal dynamics: Monitor infections over time (e.g., through 60 dpi) to capture the full progression of infection and potential adaptation .

  • Quantitative metrics: Employ standardized quantitative measurements of symptoms rather than qualitative assessments .

  • Controls: Include appropriate wild-type viruses and, when possible, synthesized ancestral variants to provide evolutionary context .

  • Multiple infection methods: Consider both artificial inoculation methods (e.g., agroinfection) and natural transmission via leafhoppers to capture potential differences in movement protein function under different infection scenarios .

By carefully considering these factors, researchers can design robust experiments that provide meaningful insights into MSV-C movement protein function across diverse host backgrounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.