Recombinant Maize streak virus genotype D Movement protein (V2)

Shipped with Ice Packs
In Stock

Description

Production and Applications

The recombinant MSV-D V2 protein is synthesized in E. coli and purified for downstream analyses.

Production Protocol (derived from ):

  1. Expression: Induced in E. coli under optimized conditions.

  2. Purification: Affinity chromatography (His-tag) followed by SDS-PAGE verification.

  3. Reconstitution: Lyophilized powder dissolved in deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for stability.

Applications:

  • Structural Studies: Used to map protein-protein interactions (e.g., V2-CP binding) .

  • Host-Pathogen Interaction Models: Assessed for its role in overcoming plant defense mechanisms .

Comparative Genomics

MSV-D V2 shares sequence homology with other mastreviruses but exhibits strain-specific polymorphisms. For example:

  • Recombination Events: MSV-A (maize-adapted) emerged via recombination between grass-adapted strains (e.g., B and G), highlighting the role of V2 in host adaptation .

  • Functional Conservation: Despite recombination, V2’s core functions in movement and nuclear export are conserved across genotypes .

Functional Studies

  • V2-CP Interactions: MSV-D V2 likely requires CP for encapsidation and systemic spread, as demonstrated in other MSV strains .

  • Host Range Determinants: Variations in V2 may explain MSV-D’s preference for specific grass hosts over maize .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes 50% glycerol as a final concentration. Customers can use this as a reference point.
Shelf Life
The shelf life of our products is influenced by multiple factors, including storage conditions, buffer components, temperature, and inherent protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal stability, we recommend aliquoting for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
V2; Movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Maize streak virus genotype D (isolate Raw) (MSV)
Target Names
V2
Target Protein Sequence
MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLVPTAPVHPGPFVPGQG
Uniprot No.

Target Background

Function
Plays a crucial role in viral transport within and between cells.
Protein Families
Mastrevirus movement protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

How does the composition of the V2 protein vary across different MSV genotypes?

While the search results primarily focus on MSV genotype E, comparative analysis across MSV genotypes reveals conserved functional domains despite sequence variations. Different MSV genotypes (A through K) show variations in their V2 protein sequences that correlate with host adaptation. For instance, MSV-A, which is adapted to maize, exhibits specific polymorphisms in its V2 region that differ from grass-adapted strains like MSV-B .

The functional significance of these variations becomes apparent in recombination studies, where exchanging V2 regions between different MSV genotypes impacts viral fitness in different hosts. When synthetic chimeras containing V2 regions from different genotypes were tested, significant differences in infectivity were observed, indicating that genotype-specific V2 sequences contribute to host adaptation .

What experimental evidence demonstrates the essential nature of V2 protein for viral movement?

Experimental evidence for the essential role of V2 in viral movement comes from multiple approaches:

  • Gene disruption studies: When the V2 gene is deleted or significantly altered, MSV cannot establish systemic infections, remaining confined to initially inoculated cells .

  • Chimeric virus experiments: Swapping the V2 gene between viral strains with different host ranges alters the host specificity of the recombinant viruses. For example, research demonstrated that recombinant viruses containing the mp (V2) region resulted in different infection frequencies (>54%) when placed in an MSV-A genetic background .

  • Symptom development correlation: The functional capacity of V2 directly correlates with symptom severity. Partially synthetic genomes containing defective V2 regions showed reduced symptom development, with infection frequencies as low as 3-9% for severely compromised V2 variants .

These lines of evidence collectively establish V2 as an indispensable viral factor for effective movement and pathogenesis.

What expression systems are optimal for recombinant MSV V2 protein production?

Bacterial expression systems, particularly E. coli, have proven effective for recombinant MSV V2 protein production. The search results indicate that recombinant full-length MSV genotype E Movement protein has been successfully expressed in E. coli with an N-terminal His tag . This approach offers several advantages:

  • High yield: E. coli systems typically provide substantial protein yields for structural and functional analyses.

  • Purification efficiency: The addition of an N-terminal His tag facilitates purification using affinity chromatography methods.

  • Cost-effectiveness: Bacterial expression is relatively inexpensive compared to eukaryotic expression systems.

For researchers pursuing this approach, the following methodology is recommended:

  • Clone the V2 gene (303 bp) into a bacterial expression vector containing an N-terminal His tag.

  • Transform into an appropriate E. coli strain (e.g., BL21(DE3)).

  • Induce expression using IPTG at optimal conditions (typically 0.5-1 mM IPTG, 16-37°C).

  • Harvest cells and lyse using appropriate buffers.

  • Purify using nickel affinity chromatography.

  • Confirm purity using SDS-PAGE (the product should be >90% pure) .

While E. coli is the most commonly used system, researchers investigating post-translational modifications or protein-protein interactions may consider plant-based expression systems to better mimic the native context.

What are the optimal storage and handling conditions for maintaining V2 protein stability?

Maintaining the stability and activity of recombinant V2 protein requires careful attention to storage and handling conditions. Based on available information for recombinant MSV V2 protein :

  • Storage temperature: Store at -20°C/-80°C upon receipt, with -80°C preferred for long-term storage.

  • Aliquoting: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week.

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (recommended: 50%)

    • Aliquot for long-term storage

  • Buffer composition: The protein is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which enhances stability during freeze-thaw cycles .

  • Freeze-thaw considerations: Repeated freezing and thawing significantly reduces protein activity and should be avoided. Each freeze-thaw cycle can result in structural changes that affect functional assays.

Researchers should conduct stability tests at different temperatures and pH conditions if planning extended studies, as protein stability can vary based on buffer composition and storage conditions.

What analytical methods are most effective for confirming V2 protein structure and function?

Multiple analytical methods can be employed to verify both the structural integrity and functional activity of recombinant V2 protein:

Structural Analysis Methods:

  • SDS-PAGE: Confirms molecular weight and initial purity (>90% purity is achievable) .

  • Western blotting: Verifies identity using anti-His antibodies or V2-specific antibodies.

  • Mass spectrometry: Provides precise molecular weight and can identify post-translational modifications.

  • Circular dichroism (CD): Assesses secondary structure elements (α-helices, β-sheets).

  • X-ray crystallography or NMR: For high-resolution structural determination, though challenging for membrane-interacting proteins like V2.

Functional Assay Methods:

  • Plasmodesmata binding assays: Using fluorescently labeled V2 to track localization at plasmodesmata.

  • Cell-to-cell trafficking assays: Measuring the ability of V2 to facilitate movement of macromolecules between cells.

  • Protein-protein interaction studies: Co-immunoprecipitation or yeast two-hybrid assays to identify host factors interacting with V2.

  • Complementation assays: Testing if the recombinant V2 can restore movement function in movement-defective viral mutants.

These methods collectively provide comprehensive validation of the recombinant protein's authenticity and biological activity.

How does recombination in the V2 region affect MSV fitness and host adaptation?

Recombination events involving the V2 region significantly impact MSV fitness and host adaptation. The search results provide substantial evidence regarding this relationship:

  • Modular exchange effects: Recombination experiments revealed that exchanges of the movement protein-coat protein (mp-cp) gene cassette between different MSV strains can dramatically alter host specificity and virulence . This "genetic module" approach to viral adaptation appears to be a common evolutionary strategy for MSV.

  • Fitness costs and benefits: Experimental research using synthetic chimeric MSV genomes demonstrated that while extensive recombination typically reduces fitness initially, secondary recombination events can restore fitness by recreating favorable genetic interactions . For instance, when synthetic viruses containing mp (V2) regions from different origins were tested, they showed varying degrees of infectivity, with some combinations yielding infection frequencies >54% while others produced only 3-9% infection rates .

  • Recombination hotspots: The V2 gene borders known recombination hotspots in the MSV genome, particularly near the virion-strand origin of replication (v-ori) and the interface between the coat protein gene and the short intergenic region (SIR) . This physical proximity to recombination hotspots makes the V2 gene particularly subject to evolutionary pressures.

Genome RegionRecombination FrequencyEffect on Fitness
V2 (mp) aloneModerateVariable (>54% infection in some chimeras)
mp-cp cassetteHighSeverely defective (3-9% infection) when synthetically constructed, but naturally selected recombinants show enhanced fitness
Near v-ori and cp-SIR interfaceVery high (hotspot)Critical for adaptive recombination

These findings indicate that while recombination can potentially disrupt favorable genetic interactions, it also provides a mechanism for rapid adaptation to new hosts or environmental conditions, particularly when selection pressure is high .

What methodologies are most effective for studying recombination events in the MSV genome?

Several methodologies have proven effective for studying recombination events in MSV, particularly those involving the V2 region:

  • Synthetic chimera construction: Researchers have used synthetic biology approaches to create artificial recombinants with precisely defined breakpoints. This allows for testing specific hypotheses about the fitness effects of recombination at particular genomic locations . For example, synthetic MSV chimeras were created with alternating genome segments from two different MSV strains, effectively containing 182 recombination breakpoints .

  • Co-infection experiments: Introducing multiple viral strains or synthetic chimeras into a single host allows for natural recombination to occur. This approach has been used to observe how quickly and efficiently recombination can restore fitness to defective viral genomes .

  • Selection in differentially resistant hosts: By introducing synthetic chimeras into various maize genotypes with different levels of MSV resistance, researchers can study how host resistance influences recombination patterns and selection for specific recombinants .

  • Whole-genome sequencing: Deep sequencing of viral populations from infection experiments allows for detection of recombination breakpoints and tracking the dynamics of recombinant genomes over time.

  • Statistical analysis of breakpoint distributions: Statistical methods like the Fisher's exact test have been used to determine whether recombination breakpoints occur more frequently in coding or non-coding regions under different selection conditions .

These methodologies, particularly when used in combination, provide powerful approaches for understanding the mechanisms and evolutionary significance of recombination in MSV genomes.

How do experimental findings on synthetic MSV chimeras inform our understanding of natural MSV evolution?

Experimental studies using synthetic MSV chimeras have provided critical insights into natural MSV evolution:

  • Mechanistic predisposition to recombination: Research has confirmed that certain regions of the MSV genome are mechanistically predisposed to recombination, particularly around the virion-strand origin of replication (v-ori) and the short intergenic region (SIR) . These hotspots shape the patterns of recombination observed in natural MSV populations.

  • Fitness landscapes: Studies showing that even severely defective synthetic chimeras can recover fitness through secondary recombination events suggest that recombination provides a rapid pathway for viruses to navigate fitness landscapes . This explains the frequent observation of recombinant MSV genomes in natural settings.

  • Host adaptation mechanisms: The maize-adapted strain MSV-A, which causes devastating maize streak disease throughout sub-Saharan Africa, likely arose via recombination between wild grass-adapted MSV strains approximately 100-200 years ago . Experimental work has demonstrated how such adaptive shifts can occur through specific recombination events involving the movement protein-coat protein cassette .

  • Selection pressure effects: Experiments using maize varieties with different levels of MSV resistance revealed that stronger host resistance increases selection pressure for specific recombination events that enhance viral fitness . This finding helps explain how new virulent strains emerge in response to host resistance.

  • Recombination reversibility: Despite the extreme genetic disruption in synthetic chimeras with 182 recombination breakpoints, viruses with just 1-3 secondary recombination events arose that showed greatly increased replication and infectivity . This demonstrates the remarkable capacity of recombination to both create and resolve genetic conflicts.

These insights from controlled laboratory experiments provide a mechanistic understanding of the evolutionary processes observed in natural MSV populations, helping researchers predict how MSV might evolve in response to changing agricultural practices or resistance strategies.

How does V2 protein interact with host cellular components during infection?

The V2 movement protein interacts with multiple host cellular components to facilitate viral movement and infection:

  • Plasmodesmata interactions: V2 modifies plasmodesmata (PD) to increase the size exclusion limit, allowing viral DNA complexes to pass between cells. This involves interactions with structural components of the PD and potentially host factors that regulate PD gating.

  • Cytoskeletal associations: Research suggests that V2 interacts with the plant cytoskeleton, particularly microfilaments, to facilitate intracellular trafficking of viral complexes toward the cell periphery and plasmodesmata.

  • Host defense suppression: The movement protein may also function to suppress host defense responses. By interacting with components of plant immunity, V2 can potentially interfere with antiviral signaling pathways.

  • Protein-protein interactions: V2 likely forms complexes with both viral proteins (particularly the coat protein) and host factors. These interactions are essential for coordinating the multiple functions of V2 during the infection cycle.

Understanding these interactions is crucial for developing resistance strategies targeting viral movement. Research approaches such as yeast two-hybrid screening, co-immunoprecipitation assays, and bimolecular fluorescence complementation have been employed to identify host proteins that interact with V2.

How do host genetic factors influence the effectiveness of V2-mediated viral movement?

Host genetic factors significantly impact the effectiveness of V2-mediated viral movement, as demonstrated by several research findings:

  • Differential resistance responses: Studies using maize genotypes with varying levels of MSV resistance revealed that host genetic background strongly influences the outcome of infection with viruses containing different V2 variants . This suggests host factors directly interact with or counteract V2 function.

  • Selection pressure effects: More resistant maize genotypes exert stronger selection pressure on viral populations, driving recombination events that optimize V2 function for the specific host environment . This host-pathogen co-evolution shapes the genetic diversity of V2 sequences observed in natural viral populations.

  • Resistance gene mechanisms: Some plant resistance genes specifically target viral movement functions. These resistance factors may directly interact with V2 to restrict its function or may modify cellular structures like plasmodesmata to prevent virus spread despite V2 activity.

  • Host compatibility factors: Successful viral movement requires appropriate host compatibility factors that V2 can utilize. Variations in these factors between different plant species or varieties can explain host range limitations and differential symptom severity.

The search results indicate that when synthetic MSV chimeras containing different V2 regions were introduced into maize varieties with different resistance levels, the resulting selection for functional recombinants varied significantly based on host genotype . This supports the critical role of host factors in determining the effectiveness of V2-mediated movement.

What experimental systems best represent natural V2-host interactions for laboratory studies?

Several experimental systems offer advantages for studying V2-host interactions in controlled laboratory settings:

  • Protoplast-based systems: Plant protoplasts (cells with cell walls removed) allow for studying early viral replication events and protein localization without the complexity of cell-to-cell movement. These systems are valuable for isolating specific V2 functions related to replication or host defense suppression.

  • Leaf bombardment assays: Microprojectile bombardment of leaves with constructs expressing fluorescently tagged V2 proteins enables visualization of subcellular localization and trafficking in intact plant tissues.

  • Agroinfiltration systems: Agrobacterium-mediated transient expression in Nicotiana benthamiana leaves provides a rapid system for testing V2 function, protein-protein interactions, and host factor requirements.

  • Maize seedling infection model: For studying the complete infection cycle, the standard approach involves agroinoculation of 3-day-old maize seedlings with infectious clones . This system allows for symptom development tracking and assessment of systemic spread.

  • Cell culture systems: Cultured maize cells can be used to study autonomous replication of MSV variants, as demonstrated in the search results where synthetic virus sMSV2 could replicate in cultured cells despite being unable to cause symptomatic infections in whole plants .

  • Differentially resistant maize genotypes: Using maize varieties with varying levels of MSV resistance provides a powerful system for studying how host genetic background influences V2 function and viral adaptation .

The choice of experimental system depends on the specific research question. For comprehensive studies, combining multiple approaches offers the most complete understanding of V2-host interactions.

How can MSV V2 protein be utilized as a tool for studying plant cellular trafficking?

The MSV V2 movement protein offers several unique advantages as a research tool for studying plant cellular trafficking mechanisms:

  • Plasmodesmata visualization: Fluorescently tagged V2 protein can serve as a marker for plasmodesmata localization, allowing researchers to visualize these channels in living plant tissues.

  • Size exclusion limit studies: By expressing V2 in plant tissues and monitoring the movement of differently sized molecular markers, researchers can quantify how V2 modifies plasmodesmatal permeability.

  • Cellular trafficking pathway investigation: The movement of V2 from its site of synthesis to plasmodesmata involves specific cellular trafficking pathways. Tracking this movement can reveal fundamental aspects of protein trafficking in plant cells.

  • Chimeric constructs: Creating fusion proteins between V2 domains and other proteins of interest can potentially redirect proteins to plasmodesmata or enable their cell-to-cell movement, providing insights into the sequence requirements for plasmodesmatal targeting.

  • Interactome mapping: Using V2 as bait in protein interaction screens can identify novel components of plant intercellular communication pathways.

These applications make V2 a valuable tool beyond viral pathology research, contributing to fundamental understanding of plant cellular communication and trafficking mechanisms.

What cutting-edge technologies are advancing our understanding of V2 protein function?

Several cutting-edge technologies are revolutionizing research on MSV V2 protein:

  • Cryo-electron microscopy: This technology enables high-resolution structural analysis of V2 in its native conformation, potentially revealing how it interacts with viral DNA and host factors.

  • Live-cell super-resolution microscopy: Techniques like PALM and STORM allow visualization of V2 trafficking and localization with nanometer precision in living cells, providing unprecedented insights into its dynamic behavior.

  • CRISPR-Cas9 genome editing: This technology enables precise modification of host plant genes to study how specific host factors influence V2 function. By creating knockout or modified lines for potential V2-interacting proteins, researchers can definitively establish their roles in viral movement.

  • Single-molecule tracking: Following individual V2 molecules in living cells reveals the kinetics and mechanisms of V2 movement and interactions with cellular structures.

  • Proximity-dependent labeling: Techniques like BioID or APEX2 fusion with V2 allow identification of proteins that transiently interact with V2 in living cells, capturing the dynamic interactome of V2 during infection.

  • Deep mutational scanning: Systematic mutation of V2 followed by functional screening identifies critical residues for various V2 functions, providing a comprehensive map of structure-function relationships.

  • Single-cell transcriptomics: This approach reveals how individual cells respond to V2 expression, capturing the heterogeneity of host responses that might be missed in bulk tissue analyses.

These technologies are generating more detailed and accurate information about V2 structure, function, and interactions than was previously possible with conventional approaches.

What are the most promising strategies for developing MSV resistance targeting V2 function?

Several innovative strategies targeting V2 function show promise for developing durable MSV resistance:

  • RNA interference (RNAi): Expressing hairpin RNAs targeting the V2 gene has shown efficacy in reducing viral replication and movement. The high sequence conservation in functional domains of V2 makes this an attractive target despite viral sequence diversity.

  • CRISPR-Cas immunity: Engineered CRISPR-Cas systems targeting the V2 gene region can provide molecular immunity against MSV. This approach can be designed to target multiple viral strains simultaneously.

  • Dominant negative V2 variants: Expression of mutated V2 proteins that can interact with wild-type V2 but lack movement function can interfere with viral trafficking in a dominant negative manner.

  • Host factor engineering: Modifying host proteins that interact with V2 can disrupt viral movement without significantly affecting plant physiology. This might involve subtle modifications to plasmodesmata components or trafficking machinery.

  • Synthetic resistance genes: Designing novel plant proteins that specifically recognize V2 and trigger defense responses can provide immunity that is difficult for the virus to overcome through mutation.

  • Antibody-mediated resistance: Expression of single-chain antibodies targeting V2 can sequester the protein and prevent its function in transgenic plants.

  • Peptide inhibitors: Small peptides designed to bind critical functional domains of V2 can block its activity without the complexity of full protein expression.

The search results highlight that understanding recombination patterns and host adaptation through the V2 region is essential for developing resistance strategies that remain effective despite viral evolution . Approaches that target evolutionarily constrained regions of V2 or multiple viral components simultaneously are likely to provide the most durable resistance.

How should researchers interpret conflicting data on V2 protein function from different experimental systems?

When faced with conflicting data on V2 protein function from different experimental systems, researchers should consider several factors:

What statistical approaches are most appropriate for analyzing recombination patterns involving the V2 region?

Based on the search results and best practices in viral genomics, several statistical approaches are recommended for analyzing recombination patterns involving the V2 region:

When analyzing recombination data, researchers should:

How can researchers distinguish between V2 protein effects and other viral factors in pathogenicity studies?

Distinguishing the specific contributions of V2 from other viral factors in MSV pathogenicity requires carefully designed experimental approaches:

  • Gene swapping experiments: The search results describe experiments where specific genome fragments (including the V2 gene) were transferred between viral strains to create chimeric viruses . This approach revealed that the cell-to-cell movement-associated (mp) fragments from synthetic viruses remained reasonably functional (>54% infection frequencies) when transferred to an MSV-A genetic background, while other regions showed greater defects .

  • Mutational analysis: Introducing specific mutations in the V2 gene while keeping the rest of the viral genome constant allows researchers to attribute phenotypic changes directly to V2 alterations.

  • Trans-complementation assays: Providing functional V2 protein in trans to V2-defective viruses can determine whether observed defects are solely due to V2 dysfunction or involve other viral regions.

  • Domain swapping: Rather than exchanging entire genes, swapping specific functional domains between different viral V2 proteins can pinpoint which regions are responsible for specific phenotypic effects.

  • Differential host responses: Comparing transcriptomic or proteomic responses to wild-type virus versus V2 mutants can reveal the specific host pathways affected by V2 function.

  • Statistical pathway analysis: When analyzing complex datasets (e.g., from -omics studies), statistical pathway analysis can help identify which cellular processes are specifically disrupted by V2 versus other viral factors.

  • Time-course experiments: Since different viral proteins may function at different stages of infection, detailed time-course experiments can separate early V2-mediated events (movement) from later events mediated by other viral factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.