Recombinant Maize streak virus genotype E Movement protein (V2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Pathogenesis

The V2 protein is multifunctional:

  • Movement Facilitation: Enables cell-to-cell transport of viral DNA by interacting with the coat protein (CP) and host factors .

  • Symptom Development: Essential for systemic infection and symptom severity in maize . Deletion or mutation of V2 abolishes virion single-stranded DNA production and symptom expression .

  • Host Specificity: Recombinant studies indicate that V2 contributes to host range determination, particularly in maize genotypes .

3.1. Pathogenicity Studies

  • Mutagenesis: Insertions/deletions in V2 disrupt viral mobility and symptom induction, confirming its necessity for infection .

  • Recombination Analysis: V2 is a hotspot for interspecies recombination, influencing viral evolution and strain diversification . For example, MSV-E likely emerged via recombination between wild grass-adapted strains .

3.2. Host-Virus Interactions

  • Resistance Screening: Recombinant V2 is used to evaluate MSV-resistant maize genotypes (e.g., PAN6099) by monitoring symptom severity and viral load .

  • Protein-Protein Interactions: Binds non-specifically to ssDNA/dsDNA and mediates nuclear import of viral DNA .

Production and Purification

Recombinant V2 is typically synthesized via:

  1. Cloning: Full-length V2 gene (1–101 aa) inserted into E. coli expression vectors .

  2. Expression: Induced under optimized conditions for soluble protein yield.

  3. Purification: Affinity chromatography using Ni-NTA resins for His-tagged proteins .

Host SystemPurityYieldApplications
E. coli≥90%0.1–1 mg/mLELISA, Western blot, functional assays

Key Research Findings

  • Evolutionary Insights: MSV-E’s V2 shares 92–94% sequence identity with other MSV strains (A, B, C), but recombination hotspots at the movement protein–coat protein interface drive strain-specific adaptations .

  • Virulence Determinants: Chimeric viruses with MSV-E V2 induce milder symptoms in resistant maize compared to MSV-A variants .

  • Structural Stability: The protein retains functionality across pH 4–9 and temperatures up to 37°C, critical for in vitro assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include your request in the order notes. We will fulfill your specific demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize development with that tag.
Synonyms
V2; Movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Maize streak virus genotype E (isolate Pat) (MSV)
Target Names
V2
Target Protein Sequence
MDPQSAVYSLPRVPTAAPPNAGVPWSHVGEVAVLSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRSPIPNTLEPTAPVHPGPFVPGSG
Uniprot No.

Target Background

Function
Plays a crucial role in the movement of the virus within and between cells.
Protein Families
Mastrevirus movement protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the genomic structure of Maize streak virus and where is the V2 gene located?

Maize streak virus has a single-stranded DNA genome with a specific organization of genomic features. The diagram of the MSV genome shows the position of several key genes: V2 (movement protein gene), V1 (coat protein gene), C1/C2 genes, and non-coding regions including the short intergenic region (SIR). The V2 gene is positioned at the beginning of the virion-sense strand of the genome and encodes the movement protein essential for viral cell-to-cell transport .

The genomic structure is particularly important because recombination events in MSV often occur in specific hotspots surrounding these genes, particularly around the virion-strand origin of replication and at the interface between the coat protein gene and the short intergenic region .

How has the MSV Movement protein V2 evolved across different viral strains?

The evolution of the MSV Movement protein has been shaped by recombination events and adaptive selection pressures. Research has shown that the maize-adapted strain of MSV (MSV-A) that causes maize streak disease throughout sub-Saharan Africa likely emerged between 100 and 200 years ago through homologous recombination between two MSV strains adapted to wild grasses .

This recombination event involved the exchange of the movement protein-coat protein gene cassette, bounded by recombination hotspots in the mastrevirus genome. This modular exchange may have conferred adaptive advantages to the virus, enhancing its ability to infect maize . Evolutionary analyses have revealed that different MSV strains (such as MSV-A1, -A2, -A3, -A4, and -A6) have evolved with distinct geographical distributions across sub-Saharan Africa .

What experimental methods are used to study the function of recombinant MSV V2 protein?

Several experimental approaches are employed to study the function of recombinant MSV V2 protein:

  • Recombinant protein expression: The V2 protein can be expressed in E. coli with tags like His-tag for purification and subsequent functional analysis .

  • Plant inoculation experiments: To study the role of V2 in viral infection, researchers use Rhizobium radiobacter (formerly Agrobacterium tumefaciens) mediated delivery of infectious viral constructs to maize seedlings. This approach allows for the assessment of symptom development and viral propagation .

  • Symptom quantification: Researchers quantify infection symptoms through image analysis, measuring parameters such as chlorotic leaf area, which correlates with visual rating scales used by breeders in field assessments .

  • Site-directed mutagenesis: Specific amino acid residues in the V2 protein can be altered to determine their importance for protein function and viral pathogenicity.

How do recombination events in the MSV genome affect the functionality of the V2 movement protein?

Recombination events in the MSV genome are non-random and have significant implications for V2 functionality. Statistical analyses have demonstrated that recombination breakpoints occur with different frequencies in coding versus non-coding regions and can vary depending on the susceptibility of the host genotype .

Notably, the maize-adapted MSV-A strain arose through a significant recombination event that included the exchange of the movement protein-coat protein gene cassette. This suggests that recombination affecting the V2 gene was instrumental in the emergence of MSV as a major pathogen of maize .

The biological significance of these recombination patterns is that they appear to optimize the balance between viral spread (mediated by the V2 movement protein) and host damage. Over time, MSV has evolved to increase the proportion of photosynthesizing leaf cells it infects while reducing chloroplast destruction in these cells, demonstrating an evolutionary trade-off between host harm and viral transmission .

What methodologies are used for detecting recombination events affecting the MSV V2 gene?

Researchers employ several specialized methodologies to detect and analyze recombination events affecting the MSV V2 gene:

  • RDP4 (Recombination Detection Program): This software suite uses multiple detection methods to identify potential recombination events in viral genomes. For MSV analysis, researchers typically align sequences from multiple isolates and apply statistical tests to identify recombination breakpoints with high confidence (probability ranges of 10^-13 to 10^-62) .

  • Fisher's exact test: This statistical method is used to determine whether recombination breakpoints occur more frequently in coding or non-coding regions of the viral genome. For example, researchers have compared the distribution of breakpoints across 2219 nt coding regions versus 470 nt non-coding regions .

  • Maximum likelihood phylogenetic analysis: This approach, as shown in the analysis of MSV isolates, can reveal evolutionary relationships that suggest recombination events. Phylogenetic trees constructed from different genomic segments can identify incongruences indicative of recombination or reassortment .

  • Bayesian continuous trait mapping: This method has been used to infer ancestral symptom intensities and evolutionary changes in virus-host interactions over time, providing context for the functional significance of recombination events affecting the V2 gene .

How does the MSV V2 protein interact with host factors in resistant versus susceptible maize genotypes?

The interaction between MSV V2 protein and host factors varies significantly between resistant and susceptible maize genotypes, leading to differential symptom expression and virus accumulation. Research using differentially resistant maize genotypes (susceptible, moderately resistant, and resistant) has revealed:

What are the latest techniques for synthesizing and validating ancestral MSV V2 protein variants for evolutionary studies?

Evolutionary studies of MSV V2 protein have employed cutting-edge techniques for reconstructing and validating ancestral viral proteins:

  • Ancestral sequence reconstruction: Researchers have used phylogenetic methods to infer the genome sequences of ancestral MSV viruses at key nodes in the evolutionary tree. For MSV, seven ancestral nodes (labeled A0 to A6) have been reconstructed to trace the evolution of viral proteins, including V2 .

  • Chemical synthesis of inferred genomes: After computational reconstruction, ancestral genome sequences are chemically synthesized to create functional viral clones. These synthetic ancestral viruses are then used in experimental infections to directly measure the symptom phenotypes they induce .

  • Validation through comparative phenotyping: The accuracy of reconstructed ancestral sequences is validated by comparing observed symptoms produced by synthesized viruses against those inferred by Bayesian continuous trait mapping. Studies have shown that these approaches yield consistent results for most cases (16/21 of chlorotic area measurements, 14/21 of chlorosis intensity measurements) .

  • Standardized experimental conditions: To ensure reliable comparison of ancestral and modern viral variants, researchers grow inoculated plants under controlled conditions (16hr light/day, 20-25°C, in biosafety level one plant growth rooms) and collect leaf samples at standardized intervals (21, 28, and 35 days post-inoculation) .

How can recombinant MSV V2 protein be used to develop virus-resistant maize varieties?

The recombinant MSV V2 protein offers several avenues for developing virus-resistant maize varieties:

  • Epitope mapping: By expressing recombinant V2 protein, researchers can identify key functional domains and epitopes that interact with host factors. This information can guide breeding programs to select for maize varieties with genetic variations that disrupt these interactions.

  • Resistance screening: Purified recombinant V2 protein can be used to screen maize germplasm for binding to potential host susceptibility factors, identifying varieties with reduced affinity as candidates for resistance breeding.

  • Transgenic approaches: Knowledge of V2 protein structure and function can inform the development of transgenic strategies, such as expressing modified versions of host factors that interact with V2 or using RNA interference targeting the V2 gene to disrupt viral movement.

  • Evolutionary insights: Studies of MSV evolution have revealed that while symptoms reflecting harm to the host have remained constant or decreased over time, there has been an increase in how extensively MSV colonizes cells upon which transmission vectors feed . This evolutionary trade-off suggests that resistance strategies targeting the virus's colonization abilities may be particularly effective.

What statistical methods are most appropriate for analyzing recombination patterns in the MSV V2 gene region?

Multiple statistical approaches are used to analyze recombination patterns in the MSV V2 gene region, each with specific applications:

Statistical MethodApplicationSignificance ThresholdReference
Fisher's exact testComparing breakpoint frequencies in coding vs. non-coding regionsTwo-tailed p-value < 0.05
Mann-Whitney testComparing genomic similarity of recombinant virusesTwo-tailed p-value < 0.05
Bootstrap analysisSupport for phylogenetic groupings in maximum likelihood treesValues >70% considered significant
RDP4 methods (RDP, GENECONV, Bootscan, MaxChi, Chimaera, SiSscan, 3Seq)Detection of recombination eventsProbability ranges 10^-13–10^-62
Bayesian continuous trait mappingInferring ancestral symptom phenotypes95% confidence intervals

When analyzing recombination in MSV, researchers typically employ multiple methods in parallel to increase detection confidence. For example, six out of seven selected recombination detection methods identified potential reassortment regions in MSV isolates 2002-04 and 2002-10 with high confidence .

How does recombinant MSV V2 protein expression vary across different experimental systems?

The expression and behavior of recombinant MSV V2 protein can vary significantly across different experimental systems:

Expression SystemYieldSolubilityPost-translational ModificationsAdvantagesLimitations
E. coliHighModerate (often requires solubilization)MinimalCost-effective, rapid, high yieldLack of eukaryotic modifications
Plant-based expressionModerateHighNative plant modificationsAuthentic folding, appropriate modificationsSlower, potentially lower yield
Insect cell systemsModerate-HighHighMore complex modificationsBetter folding than bacteriaMore expensive than E. coli
Cell-free systemsVariableVariableMinimalRapid, avoids toxicity issuesExpensive, lower yield

For research applications, E. coli expression systems are commonly used due to their efficiency and cost-effectiveness. The recombinant V2 protein (101 amino acids) is typically produced with an N-terminal His-tag to facilitate purification . After purification, the protein is often stored as a lyophilized powder and reconstituted in deionized sterile water to concentrations of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage stability .

What are the most promising future research directions for understanding MSV V2 protein function?

Several promising research directions will advance our understanding of MSV V2 protein function:

  • Structural biology approaches: Determining the three-dimensional structure of the V2 protein through X-ray crystallography or cryo-electron microscopy would provide crucial insights into its function and interaction with host factors.

  • Host-pathogen interactomics: Comprehensive identification of host proteins that interact with V2 using techniques such as yeast two-hybrid screening, co-immunoprecipitation coupled with mass spectrometry, or proximity-dependent biotin labeling would reveal cellular pathways exploited by the virus.

  • CRISPR-based functional genomics: Using CRISPR/Cas9 technology to create maize lines with targeted modifications in genes that interact with V2 could validate the importance of these interactions and potentially lead to engineered resistance.

  • Comparative analysis across MSV strains: Expanding comparative studies of V2 proteins from different MSV strains (beyond MSV-A) will help elucidate the molecular basis for host range expansion and adaptation.

  • Integration with systems biology: Combining genomic, transcriptomic, and proteomic data to build network models of V2-mediated pathogenesis would provide a more comprehensive understanding of MSV infection dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.