Recombinant Malacomys longipes Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Malacomys longipes (Big-eared swamp rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELANFHDHTLMIVFLISSLVLYIISSMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS YMVPTNDLKPGDLRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI
Uniprot No.

Target Background

Function
Recombinant Malacomys longipes Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase. These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1—a binuclear center (BNC) formed by heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Malacomys longipes Cytochrome c oxidase subunit 2 (MT-CO2) and what is its significance in research?

Malacomys longipes (Big-eared swamp rat) Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrial protein that forms a critical component of the cytochrome c oxidase (COX) complex. This protein plays an essential role in the electron transport chain as it is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, a crucial step in cellular respiration and ATP production . The recombinant form of this protein is particularly valuable for comparative studies of mitochondrial function across species, investigation of evolutionary relationships, and understanding the molecular mechanisms of cellular respiration. Research on MT-CO2 contributes to our knowledge of mitochondrial genetics, protein-protein interactions in membrane-bound complexes, and evolutionary biology.

What are the structural characteristics and functional domains of MT-CO2?

The MT-CO2 protein from Malacomys longipes consists of 227 amino acids and contains several functionally important domains. The protein features a dual core CuA active site that is critical for its electron transfer function . The amino acid sequence reveals a highly conserved protein architecture that is characteristic of COII proteins across species. The protein contains transmembrane domains that anchor it within the inner mitochondrial membrane, with specific regions interacting with both the mitochondrial matrix and intermembrane space.

The functional core of MT-CO2 includes:

  • Electron transfer domains containing copper-binding sites

  • Regions for interaction with cytochrome c

  • Transmembrane helices for membrane anchoring

  • Interface regions for assembly with other COX subunits

These structural features are essential for its role in the respiratory chain, where it facilitates electron transfer from cytochrome c to the catalytic center of cytochrome c oxidase .

How should recombinant MT-CO2 be properly stored and handled in laboratory settings?

For optimal stability and activity, recombinant Malacomys longipes MT-CO2 protein should be stored according to the following protocols:

  • Long-term storage: Maintain at -20°C or preferably at -80°C for extended periods

  • Working solution: Store aliquots at 4°C for up to one week

  • Buffer composition: Use Tris-based buffer with 50% glycerol optimized for protein stability

  • Avoid repeated freeze-thaw cycles which can significantly degrade protein activity

  • For experimental use, prepare working aliquots to prevent repeated freezing and thawing of the entire stock

When handling the protein, maintain sterile conditions and use appropriate personal protective equipment. Avoid excessive agitation or vortexing which can lead to protein denaturation. If diluting the protein, use the recommended buffer conditions to maintain proper folding and activity.

What expression systems are most effective for producing recombinant MT-CO2?

Based on research with related cytochrome c oxidase subunit 2 proteins, the following expression systems have proven effective:

E. coli-based expression systems:
The E. coli Transetta (DE3) expression system combined with pET-32a vectors has been successfully used for expressing recombinant COII proteins. This system typically employs IPTG induction for controlled expression . When using bacterial expression systems, optimization of several parameters is crucial:

  • Codon optimization for E. coli if expressing eukaryotic proteins

  • Lowering induction temperature (16-25°C) to improve protein folding

  • Adjusting IPTG concentration (typically 0.1-1.0 mM) to control expression levels

  • Inclusion of fusion tags (such as 6×His-tag) to facilitate purification

For MT-CO2 specifically, expression constructs should include appropriate targeting sequences if functional studies requiring mitochondrial localization are planned .

What purification strategies are most effective for recombinant MT-CO2?

Purification of recombinant MT-CO2 typically follows a multi-step process:

  • Affinity chromatography: Using Ni²⁺-NTA agarose for His-tagged proteins has been effective for related COII proteins, yielding concentrations of approximately 50 μg/mL of purified protein .

  • Buffer optimization: Purification buffers should contain stabilizing agents such as glycerol and should be optimized for pH and ionic strength based on the protein's isoelectric point (pI), which for related COII proteins is approximately 6.37 .

  • Quality control methods:

    • SDS-PAGE to verify molecular weight (expected ~26.2 kDa for the core protein, ~44 kDa with fusion tags)

    • Western blotting using specific antibodies against COII or tag epitopes

    • UV-spectrophotometric analysis to assess functional activity

For membrane proteins like MT-CO2, inclusion of appropriate detergents in purification buffers may be necessary to maintain native conformation and prevent aggregation.

What regulatory considerations apply when working with recombinant MT-CO2?

Researchers working with recombinant proteins including MT-CO2 must adhere to specific regulatory guidelines:

  • NIH Guidelines for Research Involving Recombinant DNA Molecules must be followed by all researchers at institutions receiving NIH funding for recombinant DNA research, even if the specific project is privately funded .

  • These guidelines stipulate biosafety and containment measures for recombinant DNA research and outline critical ethical principles for research .

  • Institutional Biosafety Committee (IBC) approval is required before initiating work with recombinant proteins.

  • For international research, additional country-specific regulations may apply and should be reviewed prior to commencing work.

  • Proper documentation of all experimental procedures, risk assessments, and safety protocols must be maintained throughout the research process .

Compliance with these guidelines ensures both the safety of laboratory personnel and the scientific integrity of research involving recombinant proteins.

How can the functional activity of recombinant MT-CO2 be assessed in vitro?

Assessment of recombinant MT-CO2 functional activity requires specialized assays that measure electron transfer capabilities:

Spectrophotometric Analysis:
UV-spectrophotometer analysis can be used to measure the protein's ability to catalyze the oxidation of cytochrome c. This method monitors the change in absorbance at specific wavelengths that correspond to the oxidation state of cytochrome c .

Oxygen Consumption Assays:
Oxygen electrode measurements can quantify oxygen consumption rates in reconstituted systems containing MT-CO2 and other components of the electron transport chain. This directly measures the protein's ability to contribute to the reduction of O₂ to H₂O.

Enzyme Kinetics Analysis:
For detailed kinetic characterization, consider the following parameters:

  • Km values for interaction with cytochrome c

  • Maximal activity (Vmax) under varying conditions

  • Effects of inhibitors and activators on enzymatic activity

  • pH and temperature optima for activity

Structural Integrity Assessment:
Infrared spectrometer analysis can provide information about the protein's secondary structure and confirm proper folding .

How does MT-CO2 from Malacomys longipes compare with COII from other species in terms of sequence conservation?

Comparative analysis of cytochrome c oxidase subunit 2 across species reveals interesting evolutionary patterns:

  • Despite being a highly conserved protein due to its critical role in electron transport, significant interspecies variation has been observed. For example, in the marine copepod Tigriopus californicus, interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level .

  • Phylogenetic analysis of COII sequences can place Malacomys longipes in evolutionary context with other rodents and mammals. Multiple sequence alignment typically shows high conservation in functional domains, particularly those involved in electron transfer and copper binding.

  • Selective pressure analysis often reveals:

    • The majority of codons in COII are under strong purifying selection (ω << 1)

    • Approximately 4% of sites may evolve under relaxed selective constraint (ω = 1)

    • Some sites may experience positive selection (ω > 1), particularly at interaction interfaces with nuclear-encoded proteins

This molecular evolution pattern suggests that species-specific adaptations in COII may be driven by the need to maintain optimal interactions with nuclear-encoded components of the respiratory chain.

What are the implications of MT-CO2 research for understanding mitochondrial disease mechanisms?

Research on recombinant MT-CO2 has several important implications for understanding mitochondrial diseases:

  • Allotopic Expression Studies:
    Research has demonstrated that cytosol-synthesized Cox2 proteins can be successfully imported into mitochondria under certain conditions, suggesting potential therapeutic approaches for mitochondrial diseases caused by mtDNA mutations .

  • Protein-Protein Interaction Insights:
    Studies of MT-CO2 interactions with other components of the cytochrome c oxidase complex provide insights into assembly defects that may underlie mitochondrial diseases. For instance, research has shown that the efficiency of Cox2 biogenesis is a limiting step for successful allotopic expression .

  • Regulatory Mechanism Identification:
    Understanding how proteins like Higd1a positively regulate cytochrome c oxidase activity by directly interacting with the complex near its active center has implications for diseases characterized by impaired mitochondrial function. These regulators can potentially increase oxygen consumption and ATP synthesis under stress conditions like hypoxia .

  • Evolutionary Medicine Perspectives:
    The extensive intraspecific variation observed in some species for COII suggests that incompatibilities between mitochondrial and nuclear genomes could contribute to hybrid breakdown and, by extension, to human diseases involving mito-nuclear mismatches .

What techniques are most effective for studying MT-CO2 interactions with other proteins in the respiratory chain?

Several advanced techniques have proven effective for studying protein-protein interactions involving MT-CO2:

Co-Immunoprecipitation (Co-IP):
Endogenous binding between MT-CO2 and other components of the cytochrome c oxidase complex can be confirmed by immunocapture with specific antibodies against MT-CO2 or its binding partners, followed by reciprocal co-immunoprecipitation .

Blue Native PAGE (BN-PAGE):
This technique is valuable for analyzing intact mitochondrial complexes and can verify in vivo interactions between MT-CO2 and other proteins within the native membrane environment .

In Vitro Pull-Down Assays:
Using highly purified components, such as highly purified bovine CcO (hpCcO), can help determine direct protein-protein interactions as opposed to indirect associations within larger complexes .

Cryo-Electron Microscopy:
For high-resolution structural analysis of MT-CO2 within the cytochrome c oxidase complex, cryo-EM has become an invaluable tool to visualize interaction interfaces and conformational changes.

Molecular Docking and Simulation:
Computational approaches can predict interaction sites and binding energies between MT-CO2 and potential binding partners or small molecules. For example, molecular docking has been used to identify potential binding sites for compounds like allyl isothiocyanate (AITC) with COII proteins .

How can site-directed mutagenesis be used to study structure-function relationships in MT-CO2?

Site-directed mutagenesis provides powerful insights into MT-CO2 function through targeted amino acid substitutions:

Key Mutation Strategies:

  • Active Site Mutations: Alterations to copper-binding residues can elucidate electron transfer mechanisms

  • Interface Mutations: Changes at protein-protein interaction surfaces can reveal assembly requirements

  • Transmembrane Domain Mutations: Modifications in membrane-spanning regions can affect stability and integration

Research has demonstrated that specific mutations can dramatically affect function and assembly. For example, the W56R mutation in yeast Cox2 enables cytosol-synthesized Cox2 (cCox2 W56R) to restore respiratory growth in cox2-deficient strains . This finding illustrates how single amino acid changes can affect protein import, processing, and function.

Experimental Design Considerations:
When planning mutagenesis experiments with MT-CO2, researchers should:

  • Target highly conserved residues identified through multiple sequence alignments

  • Consider the structural context of mutations using available structural data

  • Develop robust functional assays to quantify the effects of mutations

  • Compare results across species to identify universal versus species-specific effects

What challenges exist in expressing mitochondrially-encoded proteins like MT-CO2 from nuclear genes?

Allotopic expression (expressing mitochondrial genes from the nucleus) presents several challenges:

  • Import Efficiency Limitations:
    Research in yeast has shown that only a fraction of cytosolically synthesized Cox2 proteins successfully mature in mitochondria. In one study, this allowed only approximately 60% steady-state accumulation of cytochrome c oxidase compared to wild-type levels .

  • Processing Requirements:
    Mitochondrially-encoded proteins must undergo proper processing after import, including cleavage of targeting sequences and membrane integration. The efficiency of these processes can be a limiting factor for successful expression .

  • Assembly Competition:
    When both mitochondrially-encoded and nuclearly-encoded versions of MT-CO2 are present, they compete for assembly into the cytochrome c oxidase complex. Studies show that the mitochondrially-encoded version is typically preferred, resulting in a mixed population of complexes .

  • Potential Solutions:

    • Addition of optimized mitochondrial targeting sequences

    • Codon optimization for cytosolic translation

    • Strategic mutations to enhance import and processing (like the W56R mutation in yeast)

    • Co-expression of assembly factors to improve incorporation into complexes

These findings have significant implications for developing treatments for human mitochondrial diseases through allotopic expression strategies .

What is the relationship between MT-CO2 and regulatory proteins in the respiratory chain?

MT-CO2 interacts with various regulatory proteins that modulate cytochrome c oxidase activity:

  • Interaction with Positive Regulators:
    Research has identified hypoxia-inducible domain family member 1A (Higd1a) as a positive regulator of cytochrome c oxidase. This protein is transiently induced under hypoxic conditions and increases CcO activity by directly interacting with the complex near its active center .

  • Functional Consequences:
    These interactions can lead to:

    • Increased oxygen consumption

    • Enhanced mitochondrial ATP synthesis

    • Improved cell viability under stress conditions like hypoxia

  • Regulatory Mechanisms:
    Several mechanisms of regulation have been identified:

    • Direct protein-protein interactions affecting electron transfer efficiency

    • Allosteric regulation changing conformational states

    • Post-translational modifications altering activity

    • Assembly-dependent regulation affecting complex stability

  • Verification Methods:
    These interactions can be verified through:

    • Endogenous binding confirmation via immunocapture

    • Reciprocal co-immunoprecipitation with antibodies against interaction partners

    • Blue native PAGE analysis of mitochondrial fractions

    • In vitro pull-down assays using highly purified components

Understanding these regulatory interactions offers potential therapeutic targets for conditions involving mitochondrial dysfunction.

What are the most promising future research directions involving recombinant MT-CO2?

The study of recombinant Malacomys longipes Cytochrome c oxidase subunit 2 opens several promising research avenues:

  • Comparative Evolutionary Studies:
    Investigation of the extensive intraspecific variation observed in COII across species could reveal mechanisms of co-evolution between mitochondrial and nuclear genomes .

  • Therapeutic Applications:
    Development of allotopic expression strategies for human mitochondrial diseases based on findings from model organisms like yeast, where nuclearly-encoded versions of mitochondrial proteins can successfully complement mitochondrial gene defects .

  • Regulatory Network Mapping:
    Comprehensive identification of proteins that interact with and regulate MT-CO2 function, particularly under stress conditions like hypoxia, could reveal new therapeutic targets .

  • Structure-Based Drug Design:
    Detailed structural understanding of MT-CO2 interaction surfaces could facilitate the development of compounds that modulate cytochrome c oxidase activity for research or therapeutic purposes.

  • Biomarker Development: Mutations or expression changes in MT-CO2 could serve as biomarkers for mitochondrial dysfunction in various disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.