Recombinant Malaria protein EXP-1 (EXP-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
EXP-1; Malaria protein EXP-1; Exported antigen AG 5.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-162
Protein Length
Full Length of Mature Protein
Species
Plasmodium falciparum
Target Names
EXP-1
Target Protein Sequence
EKTNKETGSGVSSKKKNKKGSGEPLIDVHDLISDMIKKEEELVEVNKRKSKYKLATSVLA GLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADNANPDADSESNGEPNADPQVTAQ DVTPEQPQGDDNNLVSGPEH
Uniprot No.

Target Background

Subcellular Location
Parasitophorous vacuole membrane.

Q&A

What is EXP-1 and what is its role in the Plasmodium lifecycle?

EXP-1 (Exported Protein 1) is a 162 amino acid protein expressed by Plasmodium falciparum that plays a critical role at multiple stages of the parasite's life cycle. It functions as a key component within the parasitophorous vacuole membrane (PVM) that separates and protects the parasite from the host cell cytosol. This protein is strategically expressed during both the liver and blood stages of the plasmodial life cycle, making it potentially an ideal target for immune responses. Its dual-stage expression pattern suggests it serves essential functions for parasite survival within the human host during different infection phases .

How conserved is the EXP-1 sequence across different Plasmodium species?

The EXP-1 sequence demonstrates remarkable conservation across various Plasmodium species and strains. This conservation is particularly evident when comparing the EXP-1 peptide sequences between P. falciparum and P. vivax. For example, P. falciparum EXP-1-P15 (RKSKYKLATSVLAGLL) and P. vivax EXP-1 aa68-82 (KKSNYKLATTVLASAL) show a high degree of sequence homology, which explains cross-species reactivity observed in immunological studies. This conservation suggests that EXP-1 serves a fundamental biological function that cannot tolerate significant structural variation without compromising parasite fitness .

How does EXP-1 relate to other known malarial antigens?

EXP-1 is also known as circumsporozoite-related antigen due to sequence similarity with the circumsporozoite protein (CSP), which is the most extensively studied malaria antigen and a key component of the RTS,S vaccine. Specifically, the amino acid sequence NANPDADSESNGEPN of EXP-1 shares similarity with the NANP-repeat region of CSP. This relationship is significant because while the NANP-repeat region of CSP has historically shown limited T cell responses, researchers have detected T cell responses against the equivalent region in EXP-1 (peptide P25), suggesting potential cross-reactivity that could have implications for vaccine development and immunity .

What types of immune responses does EXP-1 elicit in malaria-infected individuals?

EXP-1 triggers both humoral and cell-mediated immune responses in malaria-infected individuals. For cellular immunity, studies have identified specific CD4+ T cell responses against multiple EXP-1 epitopes, with approximately 47% of patients demonstrating one or more EXP-1-specific CD4+ T cell responses. Research indicates these responses target at least 15 different peptides spanning the EXP-1 protein. For humoral immunity, antibodies against EXP-1 develop in approximately 83% of individuals within 6 months of exposure to malaria in endemic regions. These antibodies have demonstrated the capacity to inhibit parasite growth both in vitro and in vivo, suggesting their potential protective role against malaria infection .

How does the breadth of EXP-1-specific T cell responses differ among patients?

The breadth of EXP-1-specific CD4+ T cell responses varies considerably among patients. In a comprehensive study of 45 patients, 21 individuals (47%) developed detectable EXP-1-specific CD4+ T cell responses, with the number of responses per patient ranging from 0 to 5 (mean: 1.09). These responses targeted 15 of the 31 tested EXP-1 peptides. Certain peptides elicited responses more frequently than others, with peptides EXP1-P13 (aa60-74) and P15 (aa70-85) being recognized by 18% and 27% of patients, respectively. This variability likely reflects differences in HLA backgrounds, previous malaria exposure, and individual immunogenetic factors that influence epitope recognition patterns .

What factors influence the sustainability of EXP-1-specific immune responses?

The sustainability of EXP-1-specific immune responses appears to be contingent upon continued parasite exposure. Longitudinal studies indicate that EXP-1-specific T cell responses wane over time following successful treatment of acute malaria infection. For example, in one patient with strong initial responses to EXP-1 peptides (frequencies of ~1.86-1.88% IFNγ+CD4+ cells), these responses became undetectable 12 months after treatment in the absence of reinfection. Conversely, another patient who experienced several subsequent malaria infections maintained detectable EXP-1-specific T cell responses over a 7-year period. This pattern aligns with epidemiological evidence suggesting that antibodies to Plasmodium antigens are inefficiently generated and rapidly lost without continued parasite exposure .

How do different host factors affect EXP-1 recognition and response patterns?

Host factors including HLA type, geographical origin, and previous malaria exposure history can theoretically influence EXP-1 recognition patterns, though direct correlations have proven challenging to establish. Studies incorporating diverse patient populations (including individuals from Germany, Africa, the Philippines, and Jamaica) with varied HLA backgrounds have identified EXP-1-specific T cell responses across this spectrum. Interestingly, comprehensive analysis has not revealed statistically significant correlations between the number or magnitude of EXP-1-specific T cell responses and relevant clinical parameters such as parasitemia, CRP levels, hemoglobin concentration, or platelet counts. This suggests that while host factors likely contribute to response variability, their effects may be complex and multifactorial .

What are the optimal methods for detecting EXP-1-specific T cell responses?

The detection of EXP-1-specific T cell responses requires sensitive methodological approaches due to their typically low ex vivo frequencies. The recommended protocol involves:

  • Isolation of peripheral blood mononuclear cells (PBMCs) from patient samples

  • Implementation of an in vitro culture expansion protocol using overlapping peptide sets spanning the entire EXP-1 protein sequence

  • Analysis by intracellular cytokine staining (ICS) for IFNγ production following peptide stimulation

  • Flow cytometric analysis to enumerate responding T cells

This approach has successfully detected responses in approximately 47% of patients studied, whereas direct ex vivo analysis without expansion typically yields very low detection rates. For even greater sensitivity, single-cell dilution cloning techniques can be employed, though these are considerably more labor-intensive .

How should researchers approach EXP-1 epitope mapping experiments?

A systematic approach to EXP-1 epitope mapping involves:

  • Initial screening with overlapping peptides (typically 15-16mers with 4-5 amino acid overlaps) spanning the entire EXP-1 sequence

  • Fine mapping of responsive regions using N- and C-terminal truncations of identified peptides

  • Testing peptide variants to account for sequence polymorphisms

  • HLA binding assays to determine restriction elements

For example, fine mapping of EXP1-P13 identified a 13-mer (EELVEVNKRKSKY) as the optimal epitope, while EXP1-P15 mapping identified a 14-mer (SKYKLATSVLAGLL) as most immunogenic. These mapping experiments should include appropriate controls and be performed with PBMCs from individuals with diverse HLA backgrounds to identify broadly recognized epitopes .

What techniques are available for studying the cross-reactivity of EXP-1 antibodies with other proteins?

The cross-reactivity of EXP-1 antibodies with other proteins, particularly HTLV-I proteins, can be studied using several complementary techniques:

  • Enzyme immunoassay (EIA) screening to detect potential cross-reactivity

  • Western blot confirmation with both target proteins (EXP-1 and potential cross-reactive proteins)

  • Blocking experiments using recombinant EXP-1 protein to inhibit binding to cross-reactive proteins

  • Immunization studies in animal models to confirm the capacity of EXP-1 to induce cross-reactive antibodies

In blocking experiments, pre-incubation of sera with recombinant EXP-1 protein can completely eliminate or greatly reduce Western blot immunoreactivity to HTLV-I proteins in samples from malaria-exposed individuals, while having no effect on truly HTLV-I-positive sera. This approach has successfully demonstrated that immune responses against EXP-1 can generate antibodies that cross-react with HTLV-I proteins .

What characteristics make EXP-1 a promising vaccine target?

EXP-1 possesses several characteristics that make it a promising vaccine target:

  • Expression at multiple life cycle stages (liver and blood stages), providing the potential for stage-transcending immunity

  • Functional importance for parasite survival, limiting the parasite's ability to tolerate mutations

  • Sequence conservation across different Plasmodium species and strains

  • Ability to elicit both CD4+ T cell and antibody responses

  • Demonstrated protection in animal models (DNA vaccines containing P. falciparum EXP1 and synthetic peptides from the C-terminal region conferred protection in mice)

  • Antibodies against EXP-1 have shown parasite growth inhibition in vitro and in vivo

These properties collectively suggest that EXP-1 may be an effective component of a multi-antigen malaria vaccine .

How might researchers optimize EXP-1-based vaccine constructs?

Optimization of EXP-1-based vaccine constructs should consider:

  • Inclusion of multiple immunogenic epitopes identified through comprehensive T cell epitope mapping

  • Focus on conserved regions to provide cross-strain and potentially cross-species protection

  • Combination with suitable adjuvants to enhance immunogenicity

  • Delivery platform selection (protein-based, DNA-based, viral vector, etc.) based on the desired immune response profile

  • Consideration of prime-boost strategies to maximize response breadth and durability

  • Potential inclusion in multi-antigen constructs alongside other malaria antigens (such as CSP) to target multiple parasite stages

Particular attention should be paid to peptides EXP1-P13 (aa60-74) and P15 (aa70-85), which have demonstrated high immunogenicity across diverse patient populations. The strong recognition of EXP-1 by both B and T cells suggests that the entire sequence may be suitable for inclusion in a subunit vaccine construct .

What are the potential challenges in developing EXP-1-based vaccines?

Several challenges must be addressed in developing EXP-1-based vaccines:

  • Waning immunity: Natural immunity to malaria, including EXP-1-specific responses, appears short-lived without continuous exposure

  • HLA diversity: Ensuring coverage of epitopes recognized across diverse HLA backgrounds

  • Limited correlation with clinical parameters: No clear correlation between EXP-1-specific T cell responses and clinical outcomes has been established

  • Cross-reactivity concerns: Potential cross-reactivity with human proteins or pathogens (such as HTLV-I) must be carefully evaluated

  • Need for appropriate adjuvants: Enhancing immunogenicity while maintaining safety profile

  • Integration with existing vaccine candidates: Determining how EXP-1 components would complement or interact with other malaria antigens in combination vaccines

Longitudinal studies showing the rapid waning of EXP-1-specific T cell responses highlight the challenge of inducing durable immunity, a common obstacle in malaria vaccine development .

How can MHC multimer technology be applied to study EXP-1-specific T cell responses?

MHC multimer technology offers significant advantages for studying EXP-1-specific T cell responses:

  • Direct ex vivo detection without the need for in vitro expansion

  • Phenotypic and functional characterization of antigen-specific T cells

  • Longitudinal tracking of specific T cell clones following vaccination or natural infection

  • Assessment of memory formation and maintenance

Implementation requires:

  • Identification of immunodominant epitopes and their HLA restrictions (as identified in fine mapping studies)

  • Generation of MHC class II multimers loaded with defined EXP-1 epitopes

  • Optimization of staining protocols for potentially low-frequency events

  • Multiparameter flow cytometry to simultaneously assess phenotypic markers

The detailed epitope mapping data from recent studies provides the foundation for developing such tools, particularly for epitopes like EXP1-P15 Truncation 1 (SKYKLATSVLAGLL), which has shown strong immunogenicity .

What is known about the cross-reactivity between EXP-1 and HTLV-I, and what are its implications for diagnostics?

The cross-reactivity between EXP-1 and HTLV-I has significant diagnostic implications:

  • Approximately 27% of individuals who develop antibodies against malaria EXP-1 also develop false-positive HTLV-I enzyme immunoassay (EIA) results

  • These false positives typically show indeterminate HTLV-I Western blot banding patterns

  • Blocking experiments with recombinant EXP-1 can eliminate or greatly reduce this cross-reactivity

  • The cross-reactivity appears to be specific to EXP-1 antibodies, as it does not affect truly HTLV-I-positive samples

This phenomenon has particular relevance in regions where both malaria and HTLV-I are endemic, potentially leading to misdiagnosis and unnecessary follow-up. Researchers and clinicians should consider recent malaria exposure when interpreting indeterminate HTLV-I serological results. Diagnostic algorithms in such regions may need to incorporate additional confirmatory testing or medical history evaluation to avoid false HTLV-I diagnoses .

How might longitudinal studies enhance our understanding of EXP-1-specific immunity?

Well-designed longitudinal studies could address several critical knowledge gaps regarding EXP-1-specific immunity:

  • Temporal dynamics of response development following primary and subsequent infections

  • Factors influencing response longevity in the absence of reinfection

  • Correlation between specific epitope recognition patterns and protection from clinical disease

  • Impact of repeat malaria exposures on response breadth, magnitude, and quality

  • Relationship between antibody and T cell responses to the same EXP-1 epitopes

What computational approaches can advance EXP-1 research?

Advanced computational approaches can significantly enhance EXP-1 research through:

  • Structural biology and molecular dynamics simulations to predict conformational epitopes and protein-protein interactions

  • Machine learning algorithms to identify patterns in epitope recognition across diverse populations

  • Systems biology approaches integrating transcriptomic, proteomic, and immunological data to understand the network effects of EXP-1 immunity

  • Population genetics analyses to track EXP-1 sequence evolution under immune pressure

  • Epitope prediction algorithms optimized for malaria antigens to guide experimental design

These computational tools would complement experimental approaches by generating testable hypotheses, optimizing experimental design, and providing frameworks for data interpretation. For example, structural analysis could help understand the mechanistic basis for the observed cross-reactivity between EXP-1 and HTLV-I proteins, potentially revealing shared structural motifs despite limited sequence homology .

What is the recommended protocol for producing recombinant EXP-1 protein for research applications?

The production of high-quality recombinant EXP-1 protein requires careful consideration of expression systems and purification strategies:

  • Expression system selection: E. coli-based systems have been successfully used, but eukaryotic systems (such as insect cells) may provide better folding and post-translational modifications

  • Construct design: Include appropriate affinity tags (His-tag, GST, etc.) for purification while ensuring they don't interfere with protein structure

  • Codon optimization: Adapt the P. falciparum sequence for the chosen expression system to improve yield

  • Purification protocol: Typically involves affinity chromatography followed by size exclusion chromatography

  • Quality control: Assess purity by SDS-PAGE, protein identity by mass spectrometry, and functional integrity by antibody recognition tests

  • Endotoxin removal: Critical for immunological applications to avoid non-specific immune activation

The resulting recombinant protein can be used for antibody production, immunization studies, blocking experiments, and structural analyses. Careful quality control is essential, particularly for immunological applications where contaminants could confound results .

How should researchers design experiments to evaluate EXP-1's potential as a vaccine component?

A comprehensive evaluation of EXP-1's vaccine potential requires a multi-faceted experimental approach:

  • Immunogenicity assessment:

    • Various delivery platforms (protein/adjuvant, DNA, viral vectors)

    • Different immunization schedules and routes

    • Measurement of humoral and cellular responses

    • Characterization of response quality (antibody isotypes, T cell cytokine profiles)

  • Protection studies:

    • Challenge experiments in appropriate animal models

    • Assessment of parasitemia, clinical symptoms, and survival

    • Passive transfer experiments to evaluate antibody-mediated protection

    • T cell depletion studies to determine the role of cellular immunity

  • Immune correlates analysis:

    • Identification of response characteristics associated with protection

    • Determination of threshold antibody titers or T cell frequencies needed

    • Evaluation of functional antibody assays (growth inhibition, phagocytosis)

  • Combination strategies:

    • Testing EXP-1 alongside established vaccine candidates (such as CSP)

    • Evaluation of potential synergistic or antagonistic effects

This systematic approach would provide comprehensive data to assess EXP-1's value as a vaccine component, either alone or in combination with other malaria antigens .

Table 1: Immunodominant EXP-1 Epitopes Identified in Human Studies

Peptide IDAmino Acid PositionSequenceRecognition FrequencyPotential HLA RestrictionNotes
EXP1-P13aa60-74EELVEVNKRKSKY18% (8/45)DRB1*08:04, *11:01P (likely)Optimal length for T cell recognition is 13-mer
EXP1-P15aa70-85RKSKYKLATSVLAGLL27% (12/45)DRB1*04:05P, *15:02P (likely)Cross-reactive with P. vivax; optimal length is 14-mer (SKYKLATSVLAGLL)
EXP1-P25Region containing NANPDADSESNGEPNNot fully specifiedNot specifiedNot determinedLocated in NANP-related region similar to CSP
EXP1-P16Adjacent to P15Not specifiedIndividual casesNot determinedDetected in long-term follow-up after multiple infections

Data compiled from search results

Table 2: Cross-Reactivity Between EXP-1 and HTLV-I Proteins

Study PopulationEXP-1 Antibody DevelopmentFalse-Positive HTLV-I EIA RateEffect of EXP-1 Blocking on Western Blot ResultsNotes
Indonesian transmigrants83% within 6 months27% of EXP-1 seroconvertersComplete elimination or great reductionParticipants seroconverted after moving to malaria-endemic area
Philippine volunteersNot specified5/6 samples (83%)Complete elimination or great reductionPreviously identified as HTLV-I EIA false positive
Mouse immunization model4/6 mice (67%) developed cross-reactive antibodiesNot applicableNot specifiedAfter three 50-μg doses of recombinant EXP-1

Data compiled from search result

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.