Recombinant Malassezia globosa Protein GET1 (GET1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
The specific tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
GET1; MGL_0439; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)
Target Names
GET1
Target Protein Sequence
MYITNDEFRVFYVRIVRFSASSKLSSMKKELFETRQLMNMTSAQDEFSKWAKLRRRVDKL
SSQVDEQNKSLASSQFVYSIMFKSFMFVLNSAIPFVLNWYYKRVPMFYLPPGDWFGPMGY
LFSFPNAPAGAVSSTVWTTVCGRVLALVGEYARELFVKDAYLVAEPPMTTEKSSGDKETT
SKLSTNKPAAMTGEKFDFGKEVKEADQPQGILKQRRANKSSD
Uniprot No.
Target Background
Function
GET1 is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble GET3, which recognizes and specifically binds the transmembrane domain of TA proteins within the cytosol.
Database Links
KEGG: mgl:MGL_0439
STRING: 425265.XP_001732664.1
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
