Recombinant Maltose transport system permease protein malG (malG)

Shipped with Ice Packs
In Stock

Description

Functional Role in the MalFGK₂ Complex

MalG partners with MalF (8 TMs) and two MalK subunits to form the MalFGK₂ transporter . Key functional insights include:

  • Energy transduction: MalK hydrolyzes ATP, coupling chemical energy to substrate translocation .

  • Substrate specificity: MalG’s periplasmic loops interact with MBP-bound maltose/maltodextrins, triggering conformational changes for transport .

  • Mutational tolerance:

    • Insertions in TM1 (residues 30–50) or periplasmic loops retain transport function .

    • Disruptions in the EAA motif or C-terminal region abolish maltodextrin uptake .

Recombinant Production and Applications

Recombinant MalG is synthesized in E. coli, yeast, or mammalian systems for biochemical studies . Example specifications from MyBioSource :

ParameterDetails
Host organismSalmonichia typhimurium (strain LT2)
Molecular weight32,225 Da
Purity≥85% (SDS-PAGE)
TagN- or C-terminal affinity tags (varies by batch)
StorageLyophilized or liquid; -20°C/-80°C
ApplicationsABC transporter assembly studies, membrane protein interaction assays

4.1. Assembly and Transport Mechanisms

  • Complex assembly: MalG requires MalF and MalK for stable integration into the membrane. Insertions in cytoplasmic loops (e.g., residues 153–157) disrupt complex formation .

  • MBP-independent mutants: Certain MalG mutants enable ATP hydrolysis without MBP, suggesting regulatory crosstalk .

4.2. Mutagenesis Studies

A transposon-based analysis of 18 MalG insertion mutants revealed:

Mutation SitePhenotypeImplication
Periplasmic loop 3Normal assembly, defective transportCritical for MBP interaction
Cytoplasmic loop 3Assembly failureEssential for MalK binding
TM1 (residues 30–50)Functional transportStructural flexibility in this region

Industrial and Research Relevance

  • Drug delivery models: MalFGK₂’s mechanism informs ABC transporter engineering for therapeutic cargo transport .

  • Protein interaction studies: Recombinant MalG enables mapping of MalF-MalG-MalK interfaces via cross-linking and cryo-EM .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
malG; VV2_1587; Maltose/maltodextrin transport system permease protein MalG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Vibrio vulnificus (strain CMCP6)
Target Names
malG
Target Protein Sequence
MAMVQGKSLKYRVWATHIALWAFLSMIIFPLLMIVAISFREGNFATGSLIPDNPSLEHWK LALGFSVTNADGSVTPPPFPVLTWLWNSVKVAGITSILIVALSTTSAYAFARLRFKGKET ILKAMMIFQMFPAVLALVALYALFDKLGQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY FETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIGVVGEVPVASLLLSDV NSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLLAQRWLVGGLTAGGVKG
Uniprot No.

Target Background

Function
Component of the ABC transporter complex MalEFGK, involved in maltose/maltodextrin uptake. It is likely responsible for substrate translocation across the membrane.
Database Links

KEGG: vvu:VV2_1587

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the maltose transport system permease protein malG and what is its function?

Maltose transport system permease protein malG is a hydrophobic cytoplasmic membrane protein required for the energy-dependent transport of maltose and maltodextrins in bacteria, particularly Escherichia coli. It serves as a critical component of the ATP-binding cassette (ABC) transporter complex MalEFGK . Within this system, malG forms part of the transmembrane channel through which maltose and maltodextrins are transported across the bacterial cytoplasmic membrane .

The malG protein, together with MalF and MalK proteins, forms a multimeric complex in the membrane consisting of two MalK subunits for each MalF and MalG subunit . This complex functions in concert with the periplasmic maltose-binding protein (MBP) to efficiently translocate maltose and maltodextrins across the bacterial cytoplasmic membrane .

How does malG structurally contribute to the maltose transport mechanism?

The malG protein contains multiple transmembrane domains with specific regions essential for its function. Sequence-function studies have identified a hydrophilic region containing the peptidic motif "EAA---G---------I-LP," highly conserved among inner membrane proteins from binding protein-dependent transport systems, that is essential for maltose transport .

Structurally, malG works alongside MalF to form the translocation pathway through which substrates pass. The periplasmic maltose-binding protein (MBP) delivers the substrate to this channel and initiates the transport process by sending a transmembrane signal to the ATPase subunits (MalK) on the cytoplasmic side of the membrane . This signal triggers ATP hydrolysis, which drives conformational changes in the transporter complex that facilitate substrate translocation through the channel formed by MalF and malG .

Interestingly, certain regions of malG are not essential for function, including:

  • A region (residues 30-50) encompassing the first predicted transmembrane segment and the first periplasmic loop

  • A region located at the middle of the protein (residues 153-157)

Additionally, a region near the C-terminus has been identified as essential for maltodextrin utilization but not for maltose transport, suggesting specialized structural requirements for different substrates .

What are effective experimental designs for studying malG function and interactions?

When designing experiments to investigate malG function and interactions, researchers can employ several validated approaches:

Insertion Mutagenesis Analysis:
A powerful approach involves creating a library of malG mutants with insertions at different positions. Studies have successfully utilized "random linker insertion mutagenesis" to isolate mutations in malG and characterize their effects on protein function . For example, research has examined "18 different MalG mutants, each containing a 31-residue insertion in the protein" to identify regions critical for assembly and transport interactions .

Complementation Assays:
These assays involve testing whether wild-type malG can restore function in strains carrying mutations in the malG gene. Studies have demonstrated that introducing plasmids carrying wild-type malG into mutant strains can reveal the nature of the mutations and their effects on transporter function .

Phage Mapping:
Recombination mapping with λp malB transducing phages provides a method for precisely locating mutations within the malG gene. Researchers can spot phage lysates on lawns of mutant strains to identify regions where recombination produces functional transporters .

Transport Assays:
Functional transport assays using radiolabeled substrates (e.g., [14C]maltose) allow quantitative measurement of transport activity in various mutant strains . These assays can be performed in whole cells or in reconstituted proteoliposomes for more controlled studies .

Structural Analysis:
Various techniques can be employed to analyze the structure of malG and its interactions, including crystallography, cryo-electron microscopy, and computational modeling based on sequence and functional data.

How can researchers effectively isolate and characterize malG mutations?

To isolate and characterize mutations in the malG gene, researchers can follow this methodological approach:

  • Mutation Generation:

    • Random mutagenesis using techniques such as linker insertion mutagenesis

    • Site-directed mutagenesis targeting specific conserved residues or domains

    • Deletion analysis to identify essential regions

  • Screening for Phenotypes:

    • Test mutants for maltose utilization on minimal media with maltose as the sole carbon source

    • Identify MBP-independent mutants that can transport maltose without requiring the maltose-binding protein

    • Screen for mutants with altered substrate specificity (e.g., able to transport maltose but not maltodextrins)

  • Genetic Mapping:

    • Use complementation tests with malF and malG derivatives to determine if mutations are in malG

    • Employ recombination mapping with λp malB transducing phages to locate mutations more precisely within the gene

  • Functional Characterization:

    • Examine protein expression and stability in mutant strains

    • Assess membrane localization and complex assembly

    • Measure transport activity using radiolabeled substrates

    • Analyze the effects of mutations on interactions with other components of the transport system

  • Classification of Mutations:

    • Assembly-defective mutants: unable to form the MalFGK₂ complex

    • Transport-defective mutants: can form the complex but cannot transport substrates

    • Substrate-specific mutants: can transport some substrates but not others

This comprehensive approach allows for detailed characterization of how specific regions of malG contribute to different aspects of transporter function.

What protocols are recommended for reconstituting the maltose transport system for in vitro studies?

For in vitro studies of the maltose transport system, reconstitution into proteoliposomes provides a controlled environment to assess function. Based on established methodologies, the following protocol framework is recommended:

1. Protein Component Preparation:

  • Purify the MalFGK₂ complex from membranes using appropriate detergents

  • Isolate MBP (maltose-binding protein) from the periplasmic fraction or through recombinant expression

  • Verify protein purity using SDS-PAGE and Western blotting

2. Liposome Preparation:

  • Create liposomes using a defined mixture of phospholipids (typically E. coli lipids or synthetic mixtures)

  • Form unilamellar vesicles through extrusion or sonication

  • Establish an appropriate internal buffer composition

3. Reconstitution Process:

  • Mix purified proteins with liposomes in the presence of detergent

  • Remove detergent gradually through dialysis, gel filtration, or adsorption onto Bio-Beads

  • Verify incorporation of proteins into liposomes

4. Functional Assessment:

  • Measure uptake of radiolabeled maltose into proteoliposomes over time

  • Assess ATP hydrolysis rates in the reconstituted system

  • Examine the effects of various conditions (pH, temperature, ion concentrations)

  • Compare wild-type and mutant proteins to identify functional domains

This approach has been successfully employed to reconstitute the maltose transport system "in a functional form both from the wild-type strain and from mutants that do not require MBP for transport" .

How do specific domains of malG contribute to substrate specificity and transport efficiency?

Research has identified several domains in malG that contribute differentially to transport of various substrates:

Essential Transport Domains:
A hydrophilic region containing the highly conserved peptidic motif "EAA---G---------I-LP" is critical for maltose transport function . This motif appears across multiple binding protein-dependent transport systems, suggesting a fundamental role in the transport mechanism.

Substrate-Specific Domains:
A region near the C-terminus of malG has been identified as essential for maltodextrin utilization but not for maltose transport . This finding suggests that different structural elements within malG are required for transporting substrates of varying sizes, with larger maltodextrins potentially requiring additional structural support for proper alignment and translocation.

MBP Interaction Domains:
Certain mutations in malG affect only transport-specific interactions with maltose-binding protein while preserving complex assembly capabilities . These represent a distinct class of mutations that specifically disrupt the communication between the periplasmic binding protein and the membrane components without affecting the basic structure of the transporter.

Assembly Domains:
Studies have identified specific hydrophilic regions of malG that are critical for assembly of the MalFGK₂ complex. Mutations in these regions result in proteins that are stably expressed but unable to form functional complexes .

These domain-specific functions highlight the complex role of malG in substrate recognition, binding protein interaction, and transport mechanism.

What structural features of malG are essential for interaction with other components of the maltose transport system?

The interaction between malG and other components of the maltose transport system depends on specific structural features:

MalF Interaction:
MalF and malG form the core translocation pathway in the membrane. Both proteins contain multiple transmembrane segments that interact to create a substrate channel. The proper folding and assembly of these proteins is interdependent, as mutations in one can affect the stability and function of the other .

MalK Interaction:
The interaction between malG and the ATP-binding protein MalK likely involves the conserved "EAA" motif in the cytoplasmic domain of malG . This interaction is crucial for coupling ATP hydrolysis to conformational changes in the transporter that drive substrate translocation.

MBP Interaction:
The periplasmic loops of malG appear to interact with the maltose-binding protein during the transport cycle. Some mutations in these regions specifically disrupt transport-specific interactions with MBP without affecting complex assembly . These interactions are essential for receiving the substrate from MBP and initiating the transport process.

The complex interplay between these proteins creates a sophisticated transport mechanism that couples ATP hydrolysis to substrate translocation across the membrane.

How can researchers analyze protein-protein interactions within the maltose transport complex?

To analyze protein-protein interactions within the maltose transport complex, researchers can employ several complementary approaches:

Genetic Approaches:

  • Suppressor Analysis: Isolate second-site suppressors that restore function to transport-defective mutations. This can identify interacting regions between different components of the system.

  • Complementation Studies: Test the ability of mutant versions of one protein to complement mutations in another protein, revealing functional interactions .

Biochemical Methods:

  • Cross-linking Studies: Use chemical cross-linkers to capture transient interactions between components, followed by mass spectrometry to identify interaction sites.

  • Co-immunoprecipitation: Precipitate one component of the complex and detect co-precipitating partners to confirm physical associations.

  • Pull-down Assays: Use tagged versions of proteins to pull down interacting partners from cell lysates.

Structural Biology Techniques:

  • X-ray Crystallography: Determine the atomic structure of the assembled complex or subcomplexes to visualize interaction interfaces.

  • Cryo-electron Microscopy: Image the complex in different conformational states to understand dynamic interactions.

  • NMR Spectroscopy: Analyze specific interaction domains and their structural changes upon binding.

Biophysical Approaches:

  • Surface Plasmon Resonance: Measure binding kinetics between purified components.

  • Isothermal Titration Calorimetry: Determine thermodynamic parameters of protein-protein interactions.

  • Fluorescence Resonance Energy Transfer (FRET): Detect proximity between labeled components in real-time.

These methods provide complementary information about the spatial arrangement, strength, and dynamics of interactions within the maltose transport complex.

What are the current models for the mechanism of maltose transport through the MalFGK complex?

Current models for maltose transport through the MalFGK complex are based on the alternating access mechanism typical of ABC transporters:

ATP-Switch Model:

  • Initial State: The transporter begins in an inward-facing conformation with the ATP-binding domains (MalK) separated.

  • Substrate Binding: Maltose-loaded MBP binds to the periplasmic face of MalF and malG.

  • Signal Transmission: MBP sends a transmembrane signal through MalF and malG to the MalK subunits .

  • ATP Binding and Dimerization: ATP binding causes the MalK subunits to dimerize, inducing a conformational change.

  • Outward-to-Inward Transition: The conformational change converts the transporter from an outward-facing to an inward-facing state.

  • Substrate Release: Maltose is released into the cytoplasm.

  • ATP Hydrolysis: ATP is hydrolyzed, causing the MalK dimer to dissociate.

  • Return to Initial State: The transporter returns to its initial inward-facing conformation.

This model explains how "a major function of MBP is to send a transmembrane signal, in the presence of ligands, to the ATPase subunits on the inner side of the membrane" . Additionally, MBP performs "a special function in the translocation of the larger ligands, maltodextrins, perhaps by aligning them for entry into the channel" .

The presence of MBP-independent mutations in malF and malG suggests that these proteins normally require the binding protein to adopt the appropriate conformation for transport, but certain mutations can allow them to adopt this conformation without MBP assistance .

What is the protein interaction network of malG?

The STRING database provides comprehensive information about protein-protein interactions involving malG. The following table summarizes key interaction partners of malG in Escherichia coli K12 :

ProteinFunctionInteraction Score
malFMaltose transporter subunit; probably responsible for substrate translocation across the membrane0.999
malEMaltose transporter subunit; binds maltose and higher maltodextrins0.999
malKMaltose ABC transporter ATPase; responsible for energy coupling0.999
lamBMaltose outer membrane porin (maltoporin); involved in maltose and maltodextrin transport0.997
ugpCSn-glycerol-3-phosphate ABC transporter ATPase0.993
malMMaltose regulon periplasmic protein; function not fully characterized0.992

These interactions represent both direct physical associations and functional relationships within the maltose transport pathway .

What experimental protocols are available for studying malG mutations?

Based on published research, the following experimental protocols have been used successfully to study malG mutations:

Protocol 1: Random Linker Insertion Mutagenesis of malG
This approach has been used to generate libraries of malG mutants for functional characterization :

  • Digest the malG gene with appropriate restriction enzymes to create random breaks

  • Ligate linker DNA sequences into these breaks

  • Transform the resulting constructs into expression vectors

  • Introduce the vectors into malG-deficient strains

  • Screen transformants for maltose utilization phenotypes

  • Sequence the mutant genes to identify insertion positions

  • Characterize mutants for protein expression, localization, and function

Protocol 2: Complementation Analysis of malG Mutations
This approach has been used to determine if mutations are in malG and to characterize their nature :

  • Introduce episomes carrying wild-type malG (such as KLF10) into mutant strains

  • Test for restoration of maltose utilization and transport

  • Perform cross-complementation with malF and malG derivatives

  • Assess phenotypes (Mal+/Mal-, Dex+/Dex-) to classify mutations

Protocol 3: Recombination Mapping of malG Mutations
This method uses phage-mediated recombination to map mutations within the malG gene :

  • Create a set of λp malB transducing phages carrying different segments of the malEFG operon

  • Spot phage lysates on lawns of mutant strains on selective media

  • Identify phages that produce recombinants with wild-type phenotype

  • Map mutations based on the minimal region of DNA required for complementation

What regions of malG have been identified as critical for function through mutational analysis?

Mutational analysis has identified several critical regions in malG. The following table summarizes key findings from insertion mutagenesis studies :

RegionPositionFunctionEffect of Mutation
Hydrophilic region with "EAA---G---------I-LP" motifNot specifiedEssential for maltose transportComplete loss of transport function
N-terminal regionResidues 30-50First transmembrane segment and first periplasmic loopCan be modified extensively with little effect on transport and no effect on protein stability/localization
Middle regionResidues 153-157Not specifiedNot essential for protein function
C-terminal regionNear C-terminusMaltodextrin utilizationEssential for maltodextrin utilization but not for maltose transport
Periplasmic regionsNot specifiedInteraction with MBPSome insertions in periplasmic regions preserve assembly and transport abilities
Two specific hydrophilic regionsNot specifiedComplex assemblyInsertions result in stable proteins unable to assemble into the MalFGK₂ complex

Additionally, specific mutations have been mapped through recombination studies :

  • Mutations mal500 and mal501: Located very late in the malF gene

  • Mutations mal506 and mal502: Located somewhat earlier in malF

  • Mutations mal510 and mal511: Located at the 3' end of the malG gene

These findings highlight the complex structure-function relationships within the malG protein and provide valuable insights for targeted studies of specific domains.

What are the latest methodological advances in studying membrane transport proteins like malG?

Recent methodological advances have significantly enhanced our ability to study membrane transport proteins like malG:

Cryo-electron Microscopy (Cryo-EM):
This technique has revolutionized the structural analysis of membrane protein complexes by allowing visualization of proteins in their native-like environment without crystallization. Cryo-EM can capture different conformational states of the transport cycle, providing dynamic views of the transport mechanism.

Advanced Mutagenesis Approaches:
Beyond traditional site-directed mutagenesis, newer approaches include:

  • Deep mutational scanning to comprehensively analyze the effects of mutations across the entire protein

  • CRISPR-Cas9 genome editing for precise chromosomal modifications

  • Unnatural amino acid incorporation to probe specific chemical interactions

Reconstitution Systems:
Advances in membrane protein reconstitution include:

  • Nanodiscs and lipid nanodiscs for stabilizing membrane proteins in a native-like lipid environment

  • Droplet interface bilayers for electrophysiological studies

  • Microfluidic platforms for high-throughput functional assays

Single-Molecule Techniques:
These approaches allow direct observation of individual transport events:

  • Single-molecule FRET to monitor conformational changes during transport

  • Atomic force microscopy to visualize structural details

  • Single-particle tracking to follow protein dynamics

Computational Methods:
Computational approaches have become increasingly powerful:

  • Molecular dynamics simulations to model transport mechanisms at atomic resolution

  • Machine learning algorithms to predict structure-function relationships

  • Systems biology approaches to understand transport proteins in their cellular context

These methodological advances offer new opportunities to understand the structure, function, and dynamics of malG and other membrane transport proteins with unprecedented detail.

How can understanding malG function contribute to broader applications in biotechnology?

Understanding the structure and function of malG could lead to several biotechnology applications:

Engineered Transport Systems:
Knowledge of how malG functions could enable the design of customized transport systems with modified substrate specificity or enhanced transport efficiency. These systems could be used in:

  • Biofuel production for efficient uptake of carbon sources

  • Bioremediation for transport of environmental pollutants into bacteria for degradation

  • Metabolic engineering to optimize nutrient uptake in industrial microorganisms

Drug Delivery Systems:
The principles of substrate recognition and transport through malG could inspire the development of:

  • Novel drug delivery vehicles based on modified transport proteins

  • Systems for targeted delivery of antimicrobials into bacterial cells

  • Screening platforms for compounds that inhibit bacterial nutrient uptake

Biosensor Development:
The maltose transport system could be engineered into biosensors for:

  • Environmental monitoring of carbohydrates in water sources

  • Quality control in food and beverage production

  • Diagnostic applications detecting specific molecules

Structural Biology Platforms:
The extensive knowledge of malG structure-function relationships makes it a valuable model system for:

  • Testing new approaches to membrane protein expression and purification

  • Validating computational methods for predicting membrane protein folding

  • Developing improved systems for membrane protein crystallization

Antimicrobial Development:
Understanding essential transport mechanisms in bacteria can lead to:

  • New targets for antimicrobial development

  • Strategies to enhance uptake of existing antibiotics

  • Approaches to overcome transport-based antimicrobial resistance

These applications represent the broader impact of fundamental research on malG and highlight the potential for translating basic science into biotechnological innovations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.