Recombinant Malus domestica Defender against cell death 1 (DAD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Malus domestica (Apple) (Pyrus malus)
Target Names
Target Protein Sequence
MGKASHSSTAQDAVALFDSLRSAYSATPTTLKIIDLYIGFAVSTALIQVVYMAIVGSFPF NSFLSGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHMVIMNFLG
Uniprot No.

Target Background

Function

A subunit of the oligosaccharyltransferase (OST) complex, it catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation. N-glycosylation occurs co-translationally, with the complex associating with the Sec61 complex at the channel-forming translocon complex mediating protein translocation across the endoplasmic reticulum (ER). All subunits are necessary for maximal enzyme activity.

Database Links

KEGG: mdm:103436627

UniGene: Mdo.2947

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Malus domestica DAD1 and what are its primary functions?

Defender against apoptotic cell death 1 (DAD1) is a highly conserved protein that plays a critical role in preventing programmed cell death (apoptosis). In Malus domestica (apple), DAD1 functions as an essential component of the oligosaccharyltransferase (OST) complex responsible for protein N-glycosylation in the endoplasmic reticulum (ER) . Loss of DAD1 function triggers ER stress, activates unfolded protein response (UPR) signaling pathways, and ultimately leads to cell apoptosis, affecting tissue growth and development . The protein is particularly important during developmental processes and stress responses in apple tissues.

How conserved is DAD1 across different species?

DAD1 is remarkably conserved across eukaryotic organisms from yeast to plants and mammals. Research has demonstrated that DAD1 homologs share high sequence similarity and functional conservation. For example, studies in Drosophila have shown that dDAD1 loss leads to increased apoptosis and reduced tissue growth through activation of JNK signaling and ER stress . This high degree of conservation suggests that experimental findings from model organisms can often be extrapolated to understand Malus domestica DAD1 function, though species-specific variations must be considered when designing experiments.

How does DAD1 relate to N-glycosylation in apple tissues?

DAD1 serves as an essential subunit of the oligosaccharyltransferase (OST) complex that catalyzes the transfer of pre-assembled oligosaccharides to nascent polypeptides in the ER. In apple tissues, DAD1 is crucial for proper protein N-glycosylation, which affects protein folding, stability, and function . When DAD1 function is compromised, improper glycosylation of proteins occurs, leading to accumulation of misfolded proteins in the ER, triggering ER stress and activating the unfolded protein response (UPR). This ultimately impacts various developmental processes and stress responses in apple tissues, including fruit development and ripening.

What are the most effective methods for cloning and expressing recombinant Malus domestica DAD1?

For successful cloning and expression of recombinant Malus domestica DAD1, researchers should follow this optimized protocol:

  • RNA Extraction and cDNA Synthesis: Extract total RNA from apple tissues (preferably young leaves or developing fruits) using a modified CTAB method optimized for high-polysaccharide plant tissues. Synthesize cDNA using oligo(dT) primers and reverse transcriptase.

  • PCR Amplification: Design primers based on conserved regions of the DAD1 gene with appropriate restriction sites. The PCR reaction should be performed in 1× PCR Buffer, 0.25 mM dNTPs, 1 μM each primer, and 0.05 U/μl Taq polymerase with an optimized profile: 5 min at 95°C, followed by 35-40 cycles of 60s at 94°C, 60s at the appropriate annealing temperature, and 90s extension at 72°C .

  • Expression System Selection: For functional recombinant DAD1, E. coli expression systems often yield insoluble protein due to the membrane-associated nature of DAD1. Instead, consider using:

    • Insect cell expression systems (Sf9 or High Five cells)

    • Yeast expression systems (Pichia pastoris)

    • Plant-based expression systems for proper post-translational modifications

  • Purification Strategy: Use poly-histidine tags for initial IMAC purification, followed by size exclusion chromatography to obtain pure protein. For membrane-associated variants, consider detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside.

How can researchers validate the biological activity of recombinant Malus domestica DAD1?

To validate the biological activity of recombinant Malus domestica DAD1, researchers should implement multiple complementary approaches:

  • In vitro N-glycosylation assay: Measure the ability of purified recombinant DAD1 to restore N-glycosylation activity in cell-free systems using fluorescently labeled peptide substrates containing N-glycosylation motifs.

  • Complementation assays: Test whether recombinant Malus domestica DAD1 can rescue the phenotype of DAD1-deficient systems, such as dad1 mutants in Arabidopsis or temperature-sensitive dad1 yeast mutants.

  • Cell death suppression assay: Assess the ability of recombinant DAD1 to suppress induced apoptosis in apple cell cultures treated with apoptosis inducers (e.g., tunicamycin or heat shock).

  • Protein-protein interaction studies: Confirm interaction with other components of the OST complex using co-immunoprecipitation, yeast two-hybrid, or bimolecular fluorescence complementation assays.

  • Structural integrity verification: Utilize circular dichroism analysis to verify proper protein folding, as correctly folded DAD1 displays characteristic secondary structure patterns .

How does recombinant DAD1 differ structurally and functionally from native apple DAD1?

Recombinant and native Malus domestica DAD1 proteins exhibit several key differences that researchers must consider:

  • Post-translational modifications: Native DAD1 undergoes specific post-translational modifications in the plant cellular environment that may be absent or altered in recombinant systems. The most significant differences occur in glycosylation patterns, lipid modifications, and potential phosphorylation sites.

  • Membrane association: Native DAD1 is embedded in the ER membrane through multiple transmembrane domains. Recombinant DAD1 may exhibit altered membrane integration depending on the expression system used, affecting its functional properties.

  • Protein-protein interactions: The recombinant protein may lack critical interactions with other components of the OST complex that are present in the native environment, potentially affecting its functional activity.

  • Structural stability: Recombinant DAD1 often shows reduced stability compared to the native protein. Circular dichroism analysis typically reveals similar secondary structure elements between properly folded recombinant protein and native DAD1, but thermal stability profiles may differ .

What roles does DAD1 play in apple fruit development and response to stressors?

DAD1 serves multiple critical functions during apple fruit development and stress response:

  • Cell death regulation during fruit development:

    • Controls fruitlet abscission through modulation of programmed cell death in the abscission zone

    • Regulates senescence processes during fruit ripening and post-harvest storage

    • Influences seed development by controlling embryonic cell death patterns

  • Stress response modulation:

    • Protects against abiotic stressors (cold, heat, drought) by preventing premature apoptosis

    • Contributes to pathogen resistance by regulating hypersensitive response (HR)

    • Mediates responses to hormonal signals that trigger fruitlet shedding

  • Developmental patterning:

    • Affects fruit shape and size through regulation of cell number and expansion

    • Influences vascular development in developing fruits

    • Coordinates seed-fruit communication during development

The roles of DAD1 are often tied to its function in ensuring proper N-glycosylation of key developmental and stress-response proteins, which in turn affects signaling pathways, protein stability, and intercellular communication during fruit development.

How does DAD1 interact with the unfolded protein response (UPR) pathway in apple tissues?

DAD1 has a complex relationship with the unfolded protein response in apple tissues:

Understanding this complex interplay is essential for interpreting experimental results when working with recombinant DAD1 in apple research systems.

What are the main challenges in purifying biologically active recombinant Malus domestica DAD1?

Researchers face several significant challenges when purifying recombinant Malus domestica DAD1:

ChallengeDescriptionSolution
Membrane associationDAD1 contains multiple transmembrane domains, making it difficult to solubilize while maintaining native conformationUse mild detergents (DDM, CHAPS) or lipid nanodiscs for extraction; consider fusion with maltose-binding protein to enhance solubility
Low expression yieldMembrane proteins often express poorly in heterologous systemsOptimize codon usage for expression system; use inducible promoters with careful temperature control during induction
Protein aggregationHydrophobic regions promote aggregation during purificationInclude glycerol (10-15%) in all buffers; maintain low protein concentration (<1 mg/ml); perform purification at 4°C
Loss of associated lipidsNative lipid environment is crucial for proper folding and functionConsider purification in lipid-detergent mixed micelles; reconstitute purified protein into liposomes
Contamination with host proteinsDifficult to separate from host membrane proteinsUse tandem affinity tags (His-FLAG or His-Strep); implement orthogonal purification steps

To overcome these challenges, a poly(L-proline) sepharose affinity purification approach, similar to that used for recombinant Mal d 4 , can be adapted for DAD1 by incorporating appropriate fusion tags. This specialized affinity purification, combined with careful detergent selection, significantly improves yield and biological activity of the purified recombinant protein.

How can researchers effectively study the interaction between DAD1 and other components of the oligosaccharyltransferase complex?

To effectively study DAD1 interactions with other OST complex components:

  • Co-immunoprecipitation (Co-IP): Use antibodies against tagged recombinant DAD1 to pull down interacting partners from apple tissue lysates. Western blotting can then identify known OST components, while mass spectrometry can discover novel interactors.

  • Bimolecular Fluorescence Complementation (BiFC): Create fusion constructs of DAD1 and putative interacting partners with split fluorescent protein halves. Expression in plant protoplasts or Nicotiana benthamiana leaves allows visualization of interactions in vivo through reconstituted fluorescence.

  • Yeast two-hybrid screening: Although challenging for membrane proteins, modified membrane yeast two-hybrid systems can identify direct protein-protein interactions between DAD1 and other OST components.

  • Proximity labeling approaches: Fusion of DAD1 with enzymes like BioID or APEX2 allows biotinylation of proteins in close proximity when expressed in apple protoplasts, followed by streptavidin pulldown and mass spectrometry.

  • Cryo-electron microscopy: For structural studies, purify the entire OST complex with DAD1 using mild detergents and analyze by cryo-EM to determine the position and interactions of DAD1 within the complex architecture.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map interaction interfaces between DAD1 and other components by identifying protected regions during complex formation.

These complementary approaches provide a comprehensive understanding of DAD1's role within the OST complex, particularly when combined with functional assays to validate the biological significance of identified interactions.

How can CRISPR/Cas9 gene editing be utilized to study DAD1 function in apple systems?

CRISPR/Cas9 offers powerful approaches for investigating DAD1 function in apple:

  • Knockout strategies: Design sgRNAs targeting conserved regions of the DAD1 coding sequence. Since complete knockout might be lethal based on studies in other organisms , consider:

    • Inducible CRISPR systems using dexamethasone or estradiol-inducible promoters

    • Tissue-specific promoters to restrict editing to specific apple tissues

    • Creating chimeric plants with sectors of dad1 mutant tissue

  • Knockdown approaches: Utilize CRISPR interference (CRISPRi) with catalytically inactive Cas9 fused to transcriptional repressors to achieve partial reduction of DAD1 expression, avoiding lethality while enabling functional studies.

  • Domain-specific mutations: Design precise edits to modify specific functional domains:

    • Transmembrane domain modifications to alter ER localization

    • OST complex interaction sites to disrupt specific protein-protein interactions

    • Conserved catalytic residues to create separation-of-function alleles

  • Tagging strategies: Insert epitope tags or fluorescent protein coding sequences in-frame with the DAD1 coding sequence to track protein localization and interactions without disrupting function.

  • Promoter modifications: Edit the native DAD1 promoter to alter expression patterns or introduce reporter genes to monitor expression dynamics during development and stress responses.

Apple transformation protocols using Agrobacterium-mediated delivery of CRISPR components to apple explants, followed by regeneration under appropriate selection, provide an effective system for implementing these strategies. The long generation time of apple trees remains a challenge, but transient expression systems and grafting approaches can provide more rapid insights.

What methodological approaches can resolve contradictions in DAD1 functional studies across different experimental systems?

Researchers often encounter contradictory results when studying DAD1 across different experimental systems. To resolve these contradictions:

  • Standardized phenotypic characterization: Develop a comprehensive phenotyping pipeline that evaluates multiple aspects of DAD1 function:

    • Quantitative measurement of N-glycosylation using mass spectrometry

    • Assessment of ER stress markers (BiP, PDI upregulation)

    • Apoptotic markers (TUNEL assay, caspase activity)

    • Cellular ultrastructure (TEM analysis of ER morphology)

  • Multi-level analysis: Integrate data from different organizational levels:

    • Transcriptomics: RNA-seq to capture global expression changes

    • Proteomics: Quantitative proteomics focusing on N-glycosylated proteins

    • Metabolomics: Analysis of metabolic changes associated with ER stress

    • Cell biology: Live-cell imaging to track dynamic processes

  • Comparative studies across systems: Directly compare results by:

    • Expressing the same recombinant DAD1 construct across different systems

    • Using identical analytical methods across experiments

    • Conducting parallel experiments with DAD1 orthologs from different species

  • Genetic complementation: Test functional conservation by:

    • Expressing Malus domestica DAD1 in dad1 mutants of model organisms

    • Performing rescue experiments with DAD1 variants to identify critical domains

  • Environmental standardization: Control for environmental variables that may affect DAD1 function:

    • Temperature, which affects protein folding and ER stress

    • Light conditions, which influence developmental processes

    • Nutrient availability, which impacts cellular stress responses

What are the most promising future research directions for Malus domestica DAD1 studies?

The most promising future research directions for Malus domestica DAD1 include:

  • Structural biology approaches: Determine the high-resolution structure of apple DAD1 in the context of the OST complex using advanced cryo-EM techniques. This will provide insights into species-specific features and potential targets for structure-based functional studies.

  • Systems biology integration: Develop comprehensive models of DAD1 function within N-glycosylation networks and ER stress pathways. Multi-omics approaches combining transcriptomics, proteomics, and glycomics will reveal the full impact of DAD1 on cellular processes.

  • Crop improvement applications: Investigate how modulating DAD1 expression might enhance stress tolerance in apple. Targeted modifications of DAD1 expression in specific tissues could potentially improve drought resistance, pathogen defense, or post-harvest quality.

  • Comparative evolutionary studies: Analyze DAD1 sequence and functional variation across Rosaceae family members to understand how this conserved protein has been adapted for specific physiological requirements in different fruit species.

  • Development of DAD1-based diagnostic tools: Create biosensors based on DAD1's ER stress response to monitor plant health status in orchards, potentially enabling early detection of stress conditions before visible symptoms appear.

These research directions will not only advance our fundamental understanding of DAD1 biology but also provide practical applications for apple cultivation and storage technology development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.