Recombinant Malus domestica Ethylene receptor (ETR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ETR1; Ethylene receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Malus domestica (Apple) (Pyrus malus)
Target Names
ETR1
Target Protein Sequence
MLACNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVKKSAVFPYRWVLVQFGA FIVLCGATHLINLWTFSIHSRTVAMVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTREL FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA LWMPTRTGLELQLSYTLRQQNPVGYTVPIHLPVINQVFSSNRAVKISANSPVAKLRQLAG RHIPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA DQVAVALSHAAILEESMRARDLLMEQNIALDLARREAETAIRARNDFLAVMNHEMRTPMH AIIALSSLLQETELTAEQRLMVETILRSSNLLATLINDVLDLSRLEDGSLQLEIATFNLH SVFREVHNMIKPVASIKRLSVTLNIAADLPMYAIGDEKRLMQTILNVVGNAVKFSKEGSI SITAFVAKSESLRDFRAPDFFPVQSDNHFYLRVQVKDSGSGINPQDIPKLFTKFAQTQAL ATRNSGGSGLGLAICKRFVNLMEGHIWIESEGLGKGCTATFIVKLGFPERSNESKLPFAP KLQANHVQTNFPGLKVLVMDDNGVSRSVTKGLLAHLGCDVTAVSLIDELLHVISQEHKVV FMDVSMPGIDGYELAVRIHEKFTKRHERPVLVALTGSIDKITKENCMRVGVDGVILKPVS VDKMRSVLSELLEHRVLFEAM
Uniprot No.

Target Background

Function
This protein may play an early role in the ethylene signal transduction pathway, potentially functioning as an ethylene receptor or a pathway regulator.
Database Links

KEGG: mdm:103401284

UniGene: Mdo.1518

Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Malus domestica ETR1?

ETR1 in Malus domestica (apple) is a membrane-bound receptor protein with multiple functional domains. The receptor contains an N-terminal ethylene-binding domain with three membrane-spanning domains, typically localized to the endoplasmic reticulum (ER) and Golgi apparatus . The cytosolic portion exhibits histidine and/or serine/threonine protein kinase activity in vitro . ETR1 also contains a receiver domain at the C-terminus with a conserved aspartate residue for phosphotransfer, structurally similar to its well-studied Arabidopsis homolog . This architecture enables ETR1 to function effectively as a sensor for the plant hormone ethylene and transduce signals to downstream components of the ethylene response pathway.

How does ETR1 function within the ethylene signaling pathway?

ETR1 functions as a negative regulator of ethylene responses in plants. In the absence of ethylene, ETR1 actively represses ethylene responses . When ethylene binds to ETR1, the receptor's signaling is shut off, which activates downstream ethylene responses . This signaling mechanism requires a copper cofactor delivered by copper transporters such as RAN1 (Response to Antagonist 1) . Ethylene binding causes a change in the coordination chemistry of the copper cofactor, resulting in a conformational change transmitted through the receptor . Importantly, ETR1 signaling is specifically modulated by RTE1 (Reversion to Ethylene Sensitivity 1), which physically interacts with ETR1 with high affinity (Kd of 117 nM) and affects its function . This interaction is critical for the regulation of ETR1 in ethylene signaling and may help explain the distinct roles of different ethylene receptors.

What domains are essential for ETR1 function and how can they be experimentally isolated?

The key functional domains of ETR1 include:

  • Ethylene-binding domain (N-terminus): Studies have shown that the first 128 amino acids of ETR1 are sufficient for ethylene binding . This domain can be experimentally isolated through PCR amplification with domain-specific primers that introduce appropriate restriction sites, as demonstrated in research protocols .

  • Histidine kinase domain: This domain exhibits protein kinase activity in vitro, although research suggests this activity may be largely dispensable for ethylene receptor signaling . When studying this domain, it's essential to maintain proper protein folding conditions.

  • Receiver domain (C-terminus): Contains a conserved aspartate residue for phosphotransfer, though experiments have shown that phosphotransfer through ETR1 is not required for all ETR1 functions, such as silver-mediated blocking of ethylene responses .

For domain isolation, researchers have successfully used approaches such as PCR amplification of specific regions (e.g., ETR1[1-128] for the binding domain) with appropriate restriction sites for subsequent cloning . Fusion tags like GST have proven useful for purification and enhancing protein stability .

What expression systems are most efficient for producing functional recombinant ETR1?

Based on established research protocols and commercial practices, two expression systems have proven particularly effective for recombinant ETR1 production:

  • E. coli expression system: This is the most commonly used system, as evidenced by both research studies and commercial products . E. coli offers advantages including rapid growth, high protein yields, and cost-effectiveness. Commercial recombinant Malus domestica ETR1 is typically produced in E. coli with purity levels >85% as assessed by SDS-PAGE .

  • Pichia pastoris (yeast) expression system: This eukaryotic system has been successfully used for expressing the ethylene binding domains of different receptor isoforms, including ETR1 . The yeast system may provide better protein folding for the membrane-associated domains.

For full-length ETR1 containing membrane-spanning domains, specialized approaches are needed to ensure proper folding and membrane integration. When expressing just the ethylene-binding domain, fusion partners such as GST have been successfully employed . Critically, copper supplementation during expression or purification is essential, as copper is required for high-affinity ethylene binding to ETR1 .

Expression SystemAdvantagesDisadvantagesBest Applications
E. coliHigh yield, economical, simple protocolsMay have folding issues with membrane proteinsPartial domains, tryptophan-less variants for binding studies
Pichia pastorisBetter folding of eukaryotic proteins, glycosylation capabilityLonger expression time, more complex protocolsFull-length receptor, functional studies requiring proper folding

What are optimal storage conditions for maintaining ETR1 stability and activity?

Proper storage of recombinant ETR1 is critical for maintaining functionality. Based on commercial guidelines and research protocols, the following conditions are recommended:

  • Temperature conditions:

    • Long-term storage: -20°C to -80°C

    • Working aliquots: 4°C for up to one week

  • Buffer composition:

    • Include glycerol at a final concentration of 5-50% (with 50% being standard for long-term storage)

    • Maintain appropriate pH (typically 7.0-7.5)

    • Add stabilizing agents such as reducing compounds to prevent oxidation

  • Handling practices:

    • Divide into small single-use aliquots to avoid repeated freeze-thaw cycles

    • Repeated freezing and thawing is strongly discouraged as it compromises protein integrity

    • Briefly centrifuge vials before opening to bring contents to the bottom

  • Concentration and format considerations:

    • For reconstituted lyophilized protein, maintain a concentration of 0.1-1.0 mg/mL

    • Lyophilized form has a longer shelf life (approximately 12 months) compared to liquid form (6 months)

Following these guidelines will help preserve ETR1 functionality for extended periods, ensuring consistent experimental results.

What critical factors affect successful purification of active ETR1?

Purifying recombinant ETR1 while maintaining its activity requires careful consideration of several critical factors:

  • Membrane protein solubilization: As ETR1 contains membrane-spanning domains, appropriate detergent selection is crucial. Non-ionic detergents like n-dodecyl β-D-maltoside (DDM) are often effective while preserving protein structure .

  • Metal cofactor incorporation: Copper supplementation during purification is essential, as copper is required for ethylene binding . Without proper copper incorporation, the purified protein may be structurally intact but functionally inactive.

  • Reducing conditions: Maintaining reducing conditions throughout purification prevents disulfide bond formation that could affect protein conformation and activity.

  • Protein tags and fusion partners: Strategic use of affinity tags (His, GST) can improve purification efficiency, though consideration must be given to their potential impact on protein function .

  • Temperature management: Conducting purification steps at 4°C whenever possible helps minimize protein degradation and preserve activity.

  • Verification of activity: After purification, ETR1 activity should be verified through ethylene binding assays or interaction studies with known partners like RTE1 .

For studies requiring specifically the ethylene-binding domain (e.g., ETR1[1-128]), modified approaches may be used as this domain is more soluble than the full-length protein .

How does the ETR1-RTE1 interaction mechanism function and how can it be studied?

The ETR1-RTE1 interaction represents a critical regulatory mechanism in ethylene signaling. This interaction can be studied using several complementary approaches:

  • Interaction characteristics:

    • RTE1 physically associates with ETR1 with high affinity (Kd of 117 nM)

    • The interaction occurs specifically with the N-terminal ethylene-binding domain of ETR1 (amino acids 1-349)

    • RTE1 and ETR1 co-localize at the endoplasmic reticulum (ER) and Golgi apparatus

  • Methodological approaches for studying the interaction:

    • Bimolecular fluorescence complementation (BiFC): This technique has successfully revealed the interaction in vivo in both tobacco transient assays and stably transformed Arabidopsis

    • Co-immunoprecipitation: Confirms physical association in plant tissues

    • Tryptophan fluorescence spectroscopy: Using purified recombinant proteins, this approach can quantify binding affinity, as demonstrated with a tryptophan-less version of ETR1

  • Functional significance:

    • RTE1 is highly specific for ETR1 and has no apparent role in the signaling of other ethylene receptors

    • Some dominant etr1 alleles (e.g., etr1-2) are highly dependent on RTE1, while others (e.g., etr1-1) are largely RTE1-independent

    • Mutations in RTE1 can dramatically affect its association with ETR1; for example, the C161Y substitution increases the dissociation constant nearly 12-fold (Kd of 1.38 μM) and confers an ETR1 loss-of-function phenotype

This high-affinity interaction provides a potential target for modulating ethylene responses in apple, with implications for fruit development, ripening, and response to environmental stresses.

What role does copper play in ETR1 function and how can researchers manipulate this relationship?

Copper plays an essential role in ETR1 function and ethylene perception, offering multiple experimental manipulation opportunities:

  • Functional importance:

    • Copper serves as a critical cofactor required for high-affinity ethylene binding in ETR1

    • The copper ion is coordinated within the ethylene binding pocket of the receptor

    • Ethylene binding causes a change in copper coordination chemistry that triggers conformational changes in the receptor

  • Experimental manipulation approaches:

    • Copper chelation: Utilizing copper chelators to reduce copper availability and study the resulting effects on ETR1 function

    • Copper supplementation: Adding copper (typically as CuSO₄) during protein expression or in experimental systems to ensure proper ETR1 function

    • Site-directed mutagenesis: Modifying amino acids involved in copper coordination to alter ethylene binding properties

    • Metal substitution experiments: Replacing copper with other transition metals like silver to study functional consequences

  • Analytical methods:

    • Metal content analysis using ICP-MS or atomic absorption spectroscopy to quantify copper incorporation

    • Comparative ethylene binding assays with different metal cofactors

    • Structural studies to reveal the copper coordination site

  • Copper delivery system:

    • RAN1 (Response to Antagonist 1) transporter is required for copper delivery to ETR1

    • Manipulating RAN1 expression provides another approach to modulate copper availability to ETR1

Understanding the role of copper in ETR1 function provides insights into the molecular mechanism of ethylene perception and can help explain how mutations or environmental factors affecting copper availability might impact ethylene responses in apple trees.

How does silver affect ETR1 function and what are the research implications?

Silver has unique and complex effects on ETR1 function that provide valuable research tools:

  • Paradoxical effects on ethylene responses:

    • Silver ions block ethylene perception yet support ethylene binding to ETR1

    • This makes silver compounds useful tools for dissecting ethylene signaling mechanisms

  • Receptor specificity:

    • ETR1 has the predominant role in mediating silver effects

    • Loss of ETR1 significantly reduces silver's ability to block ethylene responses, while loss of other receptors has less impact

    • Silver supports ethylene binding to ETR1 and ERS1 but not other receptor isoforms

  • Quantitative binding characteristics:

    • Ethylene binding to ETR1 with silver is approximately 30% of binding with copper

    • This reduced binding is not due to altered Kd or dissociation kinetics but likely reflects fewer binding sites

  • Mechanistic independence:

    • Silver effects do not require phosphotransfer through ETR1

    • A functional RTE1 is not required for silver to block ethylene responses

  • Research applications:

    • Silver compounds (silver nitrate or silver thiosulfate) can be used experimentally to block ethylene responses

    • This approach helps distinguish between ethylene-dependent and ethylene-independent processes

    • Silver can serve as a tool to study ETR1-specific functions versus functions shared with other receptors

These findings indicate that silver has a complex mode of action in ethylene signaling, making it a valuable research tool for dissecting receptor-specific functions in apple and other plant species.

What structural changes occur in ETR1 upon ethylene binding and how can they be characterized?

The structural changes in ETR1 upon ethylene binding are central to signal transduction, though they remain incompletely characterized. Current understanding and research approaches include:

  • Primary conformational changes:

    • Ethylene binding alters the coordination chemistry of the copper cofactor in the binding site

    • This initiates conformational changes in the three membrane-spanning domains

    • These changes propagate to cytosolic domains, affecting kinase activity and protein-protein interactions

  • Techniques for structural characterization:

    • Tryptophan fluorescence spectroscopy: Using tryptophan-less versions of ETR1 with strategic tryptophan insertions can report on conformational changes

    • Limited proteolysis: Conformational changes alter protease accessibility patterns

    • FRET/BRET approaches: Can detect changes in proximity between domains or subunits

    • Hydrogen-deuterium exchange mass spectrometry: Identifies regions with altered solvent accessibility upon binding

  • Functional readouts of structural changes:

    • Changes in ETR1-RTE1 interaction dynamics

    • Alterations in associations with downstream signaling components

    • Modified oligomerization properties

  • Experimental considerations:

    • Using purified receptor protein in detergent micelles or reconstituted in liposomes

    • Comparing wild-type receptor with binding-deficient mutants

    • Examining effects of silver versus copper on conformational changes

Understanding these structural changes is essential for developing targeted approaches to modulate ethylene responses in apple, with potential applications in fruit ripening control and stress response management.

What are common challenges in ethylene binding assays with recombinant ETR1?

Researchers working with ethylene binding assays face several technical challenges that must be addressed for reliable results:

  • Cofactor-related challenges:

    • Insufficient copper incorporation: Results in reduced binding capacity despite structurally intact protein

    • Oxidation state management: Copper must be maintained in the correct oxidation state (Cu(I))

    • Metal substitution effects: Different metals (copper vs. silver) yield different binding properties

  • Membrane protein handling issues:

    • Detergent selection: Critical for maintaining ETR1 in a properly folded state

    • Lipid environment effects: The membrane environment can significantly impact binding properties

    • Protein aggregation: Can reduce active protein concentration and complicate data interpretation

  • Technical assay limitations:

    • Gas handling challenges: Ethylene's gaseous nature requires specialized equipment

    • Concentration control: Maintaining precise ethylene concentrations is technically demanding

    • Signal-to-noise ratio: Often low, particularly with radioisotope-labeled ethylene

  • Comparison across systems:

    • Full-length versus truncated constructs may show different binding characteristics

    • Ethylene binding to ETR1 with silver is approximately 30% of binding with copper, requiring normalization when comparing datasets

Challenge TypeManifestationMitigation Strategy
Cofactor issuesReduced binding capacityCopper supplementation during expression/purification
Protein qualityVariable activity between preparationsRigorous quality control and activity verification
Technical limitationsPoor reproducibilityStandardized protocols and multiple technical replicates
Data interpretationDistinguishing specific from non-specific bindingAppropriate controls including known non-binding mutants

Awareness of these challenges allows researchers to design more robust experimental approaches and correctly interpret binding data in the context of ETR1 function.

How can researchers verify that recombinant ETR1 is correctly folded and functional?

Verifying that recombinant ETR1 is correctly folded and functional is essential for meaningful experiments. Multiple complementary approaches should be employed:

  • Binding capacity assessment:

    • Ethylene binding assays to confirm high-affinity binding (nanomolar range)

    • Comparative binding with copper versus silver cofactors (expect ~30% binding with silver compared to copper)

    • Competition assays with unlabeled ethylene to determine specificity

  • Metal content analysis:

    • Quantify copper content using techniques like inductively coupled plasma mass spectrometry (ICP-MS)

    • A copper-to-protein ratio approaching 1:1 for monomeric preparations indicates potentially active protein

  • Protein-protein interaction verification:

    • Test interaction with known partners like RTE1 using interaction assays

    • Correctly folded ETR1 should interact with RTE1 with high affinity (Kd of approximately 117 nM)

    • Mutations known to affect interaction, such as C161Y in RTE1, should show expected changes in binding affinity

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure integrity

    • Tryptophan fluorescence spectroscopy using strategically placed tryptophan residues or a tryptophan-less background

    • Limited proteolysis to generate characteristic fragmentation patterns

  • Comparative analysis:

    • Side-by-side comparison with known functional and non-functional variants

    • The etr1-1 mutant, which fails to coordinate copper and cannot bind ethylene, serves as an effective negative control

These approaches provide complementary information about ETR1 folding and function, allowing researchers to proceed with confidence in downstream applications.

What experimental controls are essential when studying ETR1-protein interactions?

When investigating ETR1-protein interactions, particularly with RTE1, comprehensive controls are essential:

  • Negative interaction controls:

    • Non-interacting proteins: Include proteins known not to interact with ETR1

    • Domain specificity controls: Test interactions with non-relevant domains of ETR1

    • Competition assays: Use excess unlabeled protein to compete with labeled interaction partner

  • Positive interaction controls:

    • Established interactions: Include well-characterized ETR1 interaction pairs

    • Self-association: ETR1 dimerization can serve as an internal positive control

    • Domain-specific interactions: The N-terminal domain (residues 1-349) of ETR1 should interact with RTE1

  • Method-specific controls:

    • For BiFC assays: Empty vector controls and split fluorescent protein halves fused to non-interacting proteins

    • For co-immunoprecipitation: Antibody-only controls and pre-clearing steps

    • For tryptophan fluorescence spectroscopy: Baseline measurements with individual proteins

  • Mutation-based controls:

    • Function-altering mutations: The C161Y substitution in RTE1 increases the Kd nearly 12-fold (from 117 nM to 1.38 μM) and serves as an excellent control

    • Binding-site mutations: Alterations in the ETR1 N-terminal domain can validate interaction specificity

  • Specificity controls:

    • Test interactions with other ethylene receptor family members, as RTE1 should interact specifically with ETR1 but not other receptors

    • Examine receptor fragment specificity, as RTE1 interacts with the N-terminal ETR1 domain

These controls help establish the specificity, affinity, and biological relevance of ETR1-protein interactions, leading to more robust and convincing experimental results.

How can contradictory data about ETR1 function be reconciled through systematic analysis?

Resolving contradictory data about ETR1 function requires systematic analysis across multiple dimensions:

This systematic approach helps resolve apparent contradictions and contributes to a more nuanced understanding of ETR1 function in different contexts.

What are new approaches for studying ETR1 structure-function relationships?

Recent technological advances have opened new avenues for investigating ETR1 structure-function relationships:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of membrane proteins without crystallization

    • Can potentially capture different conformational states of ETR1 (with/without ethylene)

    • Allows study of ETR1 in more native-like membrane environments

  • Advanced computational modeling:

    • Molecular dynamics simulations to predict conformational changes upon ethylene binding

    • Homology modeling based on structurally characterized bacterial histidine kinases

    • AI-assisted protein structure prediction tools like AlphaFold for generating structural hypotheses

  • Site-specific biophysical probes:

    • Unnatural amino acid incorporation for site-specific labeling

    • Environment-sensitive fluorescent probes to detect conformational changes

    • Mass spectrometry techniques to map protein-protein interaction interfaces

  • Single-molecule approaches:

    • Single-molecule FRET to detect conformational dynamics

    • Optical tweezers or atomic force microscopy to measure structural stability

    • Super-resolution microscopy to visualize ETR1 clustering and organization

  • Gene editing approaches:

    • CRISPR-Cas9 editing of endogenous ETR1 in Malus domestica

    • Creation of domain swap chimeras between different ETR isoforms

    • Precise mutation introduction to test structure-based hypotheses

These emerging approaches promise to provide unprecedented insights into how ETR1 structure relates to its function in ethylene perception and signaling.

How does ETR1 function relate to fire blight resistance in Malus species?

Fire blight, caused by Erwinia amylovora, is a devastating bacterial disease affecting apple production. The relationship between ETR1 function and fire blight resistance involves several dimensions:

  • Ethylene's role in pathogen defense:

    • Ethylene is a key regulator of plant immune responses

    • ETR1, as an ethylene receptor, may modulate defense responses against fire blight

    • Altered ethylene sensitivity can affect susceptibility to bacterial pathogens

  • QTL mapping approaches:

    • Fire blight resistance QTLs have been identified in wild Malus species

    • Examining whether ETR1 or associated genes fall within these QTL regions could reveal functional connections

    • F1 apple populations from crosses between M. domestica cv. 'Royal Gala' × M. sieversii have been used for identifying fire blight resistance QTLs

  • Functional hypotheses:

    • ETR1 variants might differ in signaling properties, affecting defense responses

    • RTE1-ETR1 interaction strength could modulate ethylene sensitivity during pathogen attack

    • Copper availability might affect both ETR1 function and bacterial virulence

  • Experimental approaches:

    • Comparing ETR1 sequence and expression between resistant and susceptible Malus genotypes

    • Testing whether ETR1 modulation (through genetic or chemical means) affects fire blight progression

    • Examining ethylene response during bacterial infection in different genetic backgrounds

Understanding the relationship between ETR1 function and fire blight resistance could provide new strategies for developing disease-resistant apple varieties with improved fruit quality characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.