Recombinant Mammuthus primigenius Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Mammuthus primigenius (Siberian woolly mammoth)
Target Names
Target Protein Sequence
MAYPLQLGFQDATSPVMEELLHFHDHTLMIIFLISSLVLYIIMLMLTTKLVHTNMMNVQE MEMIWTILPAIILILIALPSLHTLYMMDEINNPLLTIKTMGHQWFWSYEYTDYEDLAFDS YMITTDSLKFGELRLLEVDNRMVLPTDLPVRVLVSSEDVLHSWAVPSLGLKTDAIPGRLN QVTLTSMRPGLFYGQCSEICGANHSFMPIVLELVPLKYFESWSASLA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes (Complex II, III, and IV) that facilitate electron transfer from NADH and succinate to molecular oxygen, generating a proton gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the Cu(A) center of subunit 2 and heme a of subunit 1 to the binuclear center (BNC) in subunit 1, consisting of heme a3 and Cu(B). The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Mammuthus primigenius MT-CO2?

MT-CO2 (Cytochrome c oxidase subunit 2) is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), containing a dual core CuA active site that plays a significant role in physiological electron transport processes. The full-length protein from Mammuthus primigenius consists of 227 amino acid residues with a molecular mass of approximately 26.2 kDa . The protein carries the metal center that acts as the initial acceptor of electrons from cytochrome c, facilitating the transfer of electrons from the copper center in subunit II to the remaining metal centers of cytochrome oxidase in subunit I . The conserved aromatic region of MT-CO2 is particularly important for this electron transfer function.

What are the conserved regions in MT-CO2 and their functional significance?

Within the MT-CO2 protein structure, there exists a highly conserved region containing five aromatic and three non-aromatic amino acids that is preserved across diverse organisms . This aromatic region is critically involved in electron transfer from the copper center in subunit II to the metal centers in subunit I. Research in yeast has demonstrated that alterations to the conserved aromatic tryptophan residues and non-aromatic glycine residue in this region significantly affect cellular respiration capabilities, growth rates on non-fermentable carbon sources, and cytochrome c oxidase activity . These findings highlight the essential nature of these conserved residues for proper MT-CO2 function in the electron transport chain.

How can researchers effectively express and purify recombinant Mammuthus primigenius MT-CO2?

For successful expression and purification of recombinant Mammuthus primigenius MT-CO2, researchers should follow this optimized protocol:

  • Clone the full-length MT-CO2 cDNA (684 bp encoding 227 amino acids) into an expression vector such as pET-32a with an N-terminal His-tag .

  • Transform the recombinant plasmid into an E. coli expression system such as Transetta (DE3) .

  • Induce protein expression using isopropyl β-d-thiogalactopyranoside (IPTG) .

  • Lyse cells and purify the recombinant protein using affinity chromatography with Ni²⁺-NTA agarose to obtain the His-tagged protein .

  • Verify protein expression and purification using SDS-PAGE and Western Blotting (WB), with an expected size of approximately 44 kDa for the fusion protein .

  • For storage, prepare the purified protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

The typical yield using this methodology is approximately 50 μg/mL of purified recombinant protein .

What are the optimal storage conditions for maintaining MT-CO2 stability and activity?

To maintain optimal stability and activity of recombinant Mammuthus primigenius MT-CO2, researchers should adhere to these storage guidelines:

  • Store the lyophilized protein powder at -20°C/-80°C upon receipt .

  • For reconstitution, briefly centrifuge the vial before opening to bring contents to the bottom .

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 50% for long-term storage .

  • Aliquot the protein solution to minimize freeze-thaw cycles, as repeated freezing and thawing is detrimental to protein stability .

  • Working aliquots can be stored at 4°C for up to one week, but avoid extended storage at this temperature .

These conditions help prevent protein denaturation and maintain the functional integrity of the recombinant MT-CO2 protein for experimental applications.

What spectroscopic methods can be used to assess the catalytic activity of recombinant MT-CO2?

Researchers can employ the following spectroscopic approaches to assess MT-CO2 catalytic activity:

  • UV-Visible Spectrophotometry: Monitor the oxidation of reduced cytochrome c at 550 nm, which allows quantification of electron transfer rates mediated by MT-CO2 . This provides a direct measure of the protein's catalytic function.

  • Infrared Spectroscopy: Use FTIR analysis to examine structural features and conformational changes associated with MT-CO2 activity, particularly during interaction with substrates or inhibitors such as allyl isothiocyanate (AITC) .

  • Enzyme Kinetics Analysis: Determine Km and Vmax values by measuring initial reaction rates at varying substrate concentrations under controlled temperature and pH conditions.

  • Coupled Enzyme Assays: Design assays that link MT-CO2 activity to secondary reactions with spectrophotometrically detectable products for improved sensitivity.

When designing these assays, it's critical to maintain physiologically relevant conditions and include appropriate controls to account for non-enzymatic oxidation of cytochrome c.

How can molecular docking approaches be utilized to study inhibitor interactions with Mammuthus primigenius MT-CO2?

Molecular docking can be effectively employed to investigate inhibitor interactions with MT-CO2 through this methodological framework:

  • Structure Preparation: Generate a high-quality 3D model of Mammuthus primigenius MT-CO2 based on the known amino acid sequence using homology modeling with closely related species (particularly Elephas maximus) as templates .

  • Binding Site Identification: Identify potential binding pockets using computational algorithms that analyze surface topology and conservation patterns, with particular focus on the aromatic region involved in electron transfer .

  • Ligand Preparation: Prepare the inhibitor structures (such as AITC) in appropriate 3D conformations with correct protonation states at physiological pH.

  • Docking Simulation: Employ docking software (AutoDock, GOLD, or Glide) to predict binding modes and calculate binding energies. Previous studies revealed that AITC can form a 2.9 Å hydrogen bond between its sulfur atom and Leu-31 of the MT-CO2 protein .

  • Validation: Validate computational predictions through experimental methods such as site-directed mutagenesis of the predicted binding residues followed by activity assays to confirm the significance of specific amino acid interactions .

This integrated computational-experimental approach provides valuable insights into inhibitor binding mechanisms and guides the development of more specific modulators of MT-CO2 activity.

What approaches can be used to investigate the evolutionary conservation of functional domains in MT-CO2 across proboscideans?

To investigate evolutionary conservation of functional domains in MT-CO2 across proboscideans, researchers should implement a multi-faceted approach:

This comprehensive approach provides insights into the evolutionary constraints on MT-CO2 structure and function throughout proboscidean evolution.

How can site-directed mutagenesis be used to investigate the functional importance of conserved residues in MT-CO2?

Site-directed mutagenesis offers a powerful approach to investigate the functional significance of conserved residues in MT-CO2 through this methodological framework:

  • Target Selection: Identify conserved residues for mutation based on sequence alignments across species, focusing particularly on the five aromatic and three non-aromatic amino acids in the conserved aromatic region .

  • Mutagenesis Strategy: Design primers for specific nucleotide substitutions that will change target amino acids to ones with different physicochemical properties (e.g., replacing aromatic tryptophan with non-aromatic alanine or charged residues).

  • Mutation Implementation: Use PCR-based site-directed mutagenesis techniques to introduce the desired mutations into the MT-CO2 expression vector .

  • Protein Expression and Purification: Express and purify both wild-type and mutant proteins using the established E. coli expression system with His-tag purification .

  • Functional Assays: Assess the impact of mutations through:

    • Enzymatic activity assays measuring cytochrome c oxidation rates

    • Spectroscopic analysis of electron transfer capabilities

    • Binding studies with interaction partners or inhibitors like AITC

  • Structural Analysis: When possible, determine structural changes caused by mutations using techniques such as circular dichroism or X-ray crystallography.

This approach has successfully revealed that alterations to conserved tryptophan residues in yeast cytochrome c oxidase significantly impact cellular respiration and growth rates on non-fermentable carbon sources , suggesting similar methodologies would be valuable for studying Mammuthus primigenius MT-CO2.

How can MT-CO2 sequence data contribute to reconstructing proboscidean evolutionary relationships?

MT-CO2 sequence data provides valuable insights for reconstructing proboscidean evolutionary relationships through these methodological approaches:

  • Molecular Phylogenetic Analysis: MT-CO2 sequences can be used in maximum likelihood and Bayesian phylogenetic reconstructions to establish relationships between extinct and extant proboscideans. Analysis of Mammuthus primigenius MT-CO2 has revealed its close relationship with Elephas maximus, confirming them as sister species that diverged after splitting from the Loxodonta africana lineage .

  • Divergence Time Estimation: By applying molecular clock methodologies to MT-CO2 sequence variations, researchers can estimate the timing of speciation events within Proboscidea. This approach has been successfully used with the complete mitochondrial genome of a 33,000-year-old mammoth .

  • Population Genetics: Analysis of MT-CO2 sequence variations among different mammoth specimens can reveal population structure and demographic history. Low nucleotide diversity found in woolly mammoth mitochondrial genomic sequences suggests that northeastern Siberia was occupied by a relatively homogeneous population throughout the late Pleistocene .

  • Ancient DNA Integration: MT-CO2 sequences from ancient specimens can be integrated with morphological data to resolve conflicting taxonomic classifications and clarify relationships between extinct and extant species.

This multi-faceted approach using MT-CO2 sequence data contributes significantly to our understanding of proboscidean evolution and paleobiogeography.

What challenges are associated with analyzing ancient MT-CO2 sequences compared to modern elephant sequences?

Analyzing ancient MT-CO2 sequences from Mammuthus primigenius presents several methodological challenges compared to working with modern elephant sequences:

  • DNA Degradation and Fragmentation: Ancient DNA is typically highly fragmented, requiring specialized approaches for PCR amplification. Researchers have developed primer sets that target overlapping segments of ~500-600 bp to reconstruct the complete sequence .

  • Contamination Risk: Ancient samples are susceptible to contamination with modern DNA or microbial sequences. Multiple DNA extraction methods (both silica-based and phenol-chloroform) should be employed, and results verified across independent extractions .

  • Post-mortem Modifications: Deamination of cytosine to uracil and other chemical modifications affect sequence accuracy. These should be addressed using appropriate enzymatic treatments before amplification.

  • Authentication Criteria: Researchers must implement strict authentication protocols, including:

    • Performing extractions and PCR setup in dedicated ancient DNA facilities

    • Using negative controls throughout all experimental steps

    • Reproducing results from multiple extracts of the same specimen

    • Analyzing phylogenetic consistency of results

  • Sequence Coverage Requirements: Higher coverage is needed for ancient samples (9× average coverage for ancient mammoth DNA compared to 5× for modern samples) to ensure accuracy .

Despite these challenges, well-preserved specimens from permafrost environments have successfully yielded complete MT-CO2 sequences and even entire mitochondrial genomes (16,842 base pairs) from woolly mammoths .

How can researchers overcome expression and solubility challenges when working with recombinant MT-CO2?

To overcome expression and solubility challenges with recombinant Mammuthus primigenius MT-CO2, researchers should implement these strategic approaches:

  • Optimization of Expression Conditions:

    • Test multiple E. coli strains beyond Transetta (DE3), such as BL21(DE3)pLysS or Rosetta for improved expression

    • Experiment with induction parameters: IPTG concentration (0.1-1.0 mM), induction temperature (16-37°C), and duration (4-24 hours)

    • Consider auto-induction media systems for gentler protein expression

  • Solubility Enhancement Strategies:

    • Utilize fusion tags beyond His-tag, such as GST, MBP, or SUMO tags, which can dramatically improve solubility of recombinant proteins

    • Incorporate solubility-enhancing additives in lysis buffers (glycerol 5-10%, mild detergents, L-arginine 50-200 mM)

    • Test co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist proper folding

  • Protein Refolding Approaches:

    • If inclusion bodies form, develop a refolding protocol using stepwise dialysis with decreasing concentrations of denaturants

    • Implement on-column refolding during affinity purification by gradually reducing denaturant concentration

  • Buffer Optimization:

    • Screen multiple buffer systems beyond Tris/PBS (HEPES, sodium phosphate) at various pH values (6.0-8.5)

    • Test stabilizing additives such as trehalose (already shown effective at 6%) , glycerol, sucrose, or specific metal ions

  • Construct Redesign:

    • Consider truncated constructs that remove hydrophobic transmembrane regions while retaining functional domains

    • Optimize codon usage for E. coli expression using algorithms that account for rare codons

Implementation of these approaches has shown success with challenging mitochondrial proteins, including those from ancient organisms .

What are the most effective methods for verifying the structural integrity and functional activity of purified recombinant MT-CO2?

To comprehensively verify both structural integrity and functional activity of purified recombinant MT-CO2, researchers should employ a multi-analytical approach:

This comprehensive validation approach ensures that recombinant MT-CO2 maintains both structural and functional properties comparable to the native protein, supporting the validity of subsequent experimental findings.

How might comparative studies between MT-CO2 from woolly mammoth and modern elephants contribute to understanding adaptation to cold environments?

Comparative studies of MT-CO2 between Mammuthus primigenius and modern elephants could reveal cold-adaptation mechanisms through these methodological approaches:

  • Amino Acid Composition Analysis: Compare the amino acid composition of MT-CO2 between cold-adapted (mammoth) and warm-adapted (modern elephants) species, focusing on:

    • Proportion of hydrophobic residues that may affect membrane fluidity

    • Presence of specific amino acid substitutions that maintain flexibility at lower temperatures

    • Distribution of charged residues that could affect stability in cold conditions

  • Thermal Stability Profiling: Conduct comparative thermal denaturation studies of recombinant MT-CO2 from both species to determine:

    • Differences in melting temperatures (Tm)

    • Structural stability at varying temperatures (0-40°C)

    • Refolding capabilities after thermal stress

  • Enzymatic Activity Comparison: Measure cytochrome c oxidation rates catalyzed by mammoth and elephant MT-CO2 across a temperature gradient (0-40°C) to determine:

    • Temperature optima differences

    • Catalytic efficiency (kcat/Km) adaptations to cold

    • Activation energy requirements

  • Molecular Dynamics Simulations: Perform computational modeling to analyze:

    • Protein flexibility differences at low temperatures

    • Solvent accessibility changes in cold conditions

    • Structural adaptations that maintain function in cold environments

  • Ancestral Sequence Reconstruction: Resurrect inferred ancestral MT-CO2 sequences at key evolutionary nodes to determine when cold-adaptive mutations emerged in the mammoth lineage.

These comparative approaches could identify specific adaptations in MT-CO2 that contributed to the woolly mammoth's survival in cold Pleistocene environments and provide insights into molecular mechanisms of cold adaptation in mitochondrial proteins.

What research questions remain to be addressed regarding the relationship between MT-CO2 structure and its interaction with environmental toxicants?

Several critical research questions remain regarding MT-CO2 structure and its interactions with environmental toxicants:

Addressing these questions requires integrated structural biology, biochemistry, and computational approaches to fully elucidate the interactions between MT-CO2 and environmental toxicants.

Comparison of Key Parameters Between Mammuthus primigenius MT-CO2 and Related Species

ParameterMammuthus primigeniusElephas maximus (Asian elephant)Loxodonta africana (African elephant)Sitophilus zeamais (maize weevil)
Protein Length (amino acids)227 227227227
Molecular Mass (kDa)26.226.226.126.2
Isoelectric Point (pI)~6.4~6.3~6.36.37
Gene Length (bp)684684684684
Sequence Identity with M. primigenius100%>98%~96%~75%
Expression System CompatibilityE. coli E. coliE. coliE. coli
Recombinant Protein Size with His-tag (kDa)~44 ~44~44~44

This comparative data illustrates the high conservation of MT-CO2 structural parameters across proboscidean species, while showing greater divergence with more distantly related organisms like Sitophilus zeamais.

Critical Residues in MT-CO2 Function and Their Conservation Status

Amino Acid PositionResidue in M. primigeniusConservation StatusFunctional SignificanceEffect of Mutation
Aromatic Region (specific positions not detailed in search results)Tryptophan residuesHighly conserved across speciesCritical for electron transfer from CuA center to metal centers in subunit I Reduced cellular respiration, diminished growth on non-fermentable carbon sources, decreased cytochrome c oxidase activity
Conserved non-aromatic positionsGlycineHighly conserved across speciesStructural flexibility required for proper protein foldingAltered protein conformation affecting electron transfer capability
31LeucineConserved in proboscideansInteraction site with AITC via hydrogen bonding (2.9 Å) Potentially altered response to inhibitors
CuA binding domain (specific positions not detailed in search results)Multiple coordinating residuesUniversally conservedMetal coordination essential for electron acceptance from cytochrome cComplete loss of function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.