Recombinant Mammuthus primigenius NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant MT-ND3 protein is typically expressed in E. coli expression systems, which allow for scalable production and efficient purification protocols . The addition of an N-terminal histidine tag enables purification using affinity chromatography, resulting in preparations with greater than 90% purity as determined by SDS-PAGE analysis .

Table 1: Characteristics of Recombinant MT-ND3 Protein

ParameterDescription
Source OrganismMammuthus primigenius (Siberian woolly mammoth)
Expression SystemE. coli
Protein Length115 amino acids (full length)
Molecular TagN-terminal His tag
Physical FormLyophilized powder
Purity>90% (SDS-PAGE)
UniProt IDQ38PR5
Storage Recommendation-20°C/-80°C, avoid repeated freeze-thaw cycles

Functional Role in Mitochondrial Energy Metabolism

The MT-ND3 protein plays a crucial role in cellular energy production as part of complex I in the electron transport chain. Complex I is responsible for the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane, which contributes to the electrochemical gradient used for ATP synthesis .

MT-ND3, alongside other mitochondrially-encoded subunits, forms part of the membrane domain of complex I and contributes to its proton-pumping function. Structurally, MT-ND3 is positioned in proximity to proton-translocation channels, highlighting its importance in the energy conversion process .

Recent research has demonstrated that mutations in MT-ND3 can significantly impair complex I assembly and activity, leading to reduced ATP synthesis . This underscores the critical role of this protein in maintaining efficient energy production within mitochondria.

Biochemical Properties

The recombinant MT-ND3 protein retains key biochemical properties that make it valuable for functional studies. When properly reconstituted, it can be incorporated into liposomes or membrane systems to study aspects of complex I function, including electron transport and proton translocation .

Evolutionary Significance and Adaptive Selection

Analysis of the MT-ND3 gene from woolly mammoth specimens has revealed evidence of positive selection, suggesting that this protein underwent adaptive evolution as mammoths adapted to cold, high-latitude environments . This is particularly significant given the mammoth's evolutionary history, having originated in warm, equatorial Africa before colonizing colder northern regions.

Studies of mitochondrial protein-coding genes from 75 widely distributed woolly mammoth specimens have identified several amino acid sites in mitochondrial proteins, including MT-ND3, that display strong evidence of positive selection . These adaptations likely contributed to metabolic adjustments necessary for survival in extreme cold and variable light conditions.

Clade Diversity and Temporal Distribution

Phylogenetic analyses based on complete mitochondrial genomes have revealed two distinct clades of woolly mammoths with significant interclade divergence . The analysis of complete mitochondrial genomes, including the MT-ND3 gene, suggests a surprisingly ancient coalescence age of approximately 1-2 million years between these clades .

Statistical analysis of the temporal distribution of radiocarbon-dated specimens indicates that clade II likely went extinct before clade I, possibly due to genetic drift rather than selective pressure . This finding provides context for understanding the evolutionary history of MT-ND3 variants and their potential adaptive significance.

Applications in Research and Biotechnology

The availability of recombinant MT-ND3 protein offers numerous applications in both basic and applied research fields. These include:

Paleoproteomics and Ancient Protein Studies

The recombinant MT-ND3 provides a reference for comparison with proteins recovered from ancient mammoth specimens. Recent proteomic analyses of 28,000-year-old mammoth remains have demonstrated the remarkable preservation of nuclear and mitochondrial components, including histone and lamin proteins . These findings suggest that components of the electron transport chain, including MT-ND3, may also be preserved and potentially recoverable from ancient specimens.

Clinical Relevance and Therapeutic Potential

Studies on MT-ND3 variants have significant implications for understanding human mitochondrial diseases. Recent research has identified novel variants in human MT-ND3, including m.10197G > C and m.10191T > C, that cause conditions such as Leigh syndrome or mitochondrial complex I deficiency .

Functional analyses of these variants have shown that they significantly reduce MT-ND3 protein levels, impair complex I assembly and activity, and decrease ATP synthesis . The woolly mammoth MT-ND3 provides an evolutionary perspective on these variants and may offer insights into mitochondrial adaptations to environmental stress.

Therapeutic Approaches Based on MT-ND3 Research

A promising approach for treating mitochondrial diseases caused by MT-ND3 mutations involves re-engineering techniques to deliver mitochondrial genes into mitochondria. This is achieved through codon optimization for nuclear expression and translation by cytoplasmic ribosomes .

Research has demonstrated that this approach can partially restore protein levels and complex I function, significantly improving ATP production in cells with MT-ND3 mutations . This represents a potential therapeutic strategy for mitochondrial diseases and highlights the broader impact of research on mitochondrial proteins like MT-ND3.

Laboratory Handling and Protocols

The proper handling of recombinant MT-ND3 protein is essential for maintaining its structural integrity and functional properties. Commercial preparations typically provide detailed protocols for reconstitution and storage.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference for your own preparations.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself. Generally, liquid forms maintain their stability for up to 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store upon receipt at -20°C/-80°C. To ensure optimal stability, aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process. If you require a particular tag type, please let us know, and we will prioritize your preference during the development process.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Mammuthus primigenius (Siberian woolly mammoth)
Target Names
Target Protein Sequence
MNLMATLLTNTMLTSLMVLIAFWLPQTYTYSEKTSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQANNTNLTLLMSFMLIILLAIGLAYEWLQKGLEWTK
Uniprot No.

Target Background

Function
Recombinant Mammuthus primigenius NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein plays a crucial role in catalyzing electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. The functionality of MT-ND3 is essential for the overall catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of MT-ND3 in the mitochondrial respiratory chain?

MT-ND3 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which represents the largest of the five respiratory complexes. Located in the mitochondrial inner membrane, MT-ND3 contributes to the highly hydrophobic transmembrane domain that forms the structural core of Complex I . This complex plays a critical role in catalyzing electron transfer from NADH to ubiquinone, the first step in the mitochondrial electron transport chain that ultimately drives ATP synthesis.

The functional significance of MT-ND3 is highlighted by the fact that pathogenic variants in extant species cause mitochondrial complex I deficiency (MT-C1D), which can lead to severe clinical disorders including Leigh syndrome, Leber hereditary optic neuropathy, and encephalopathy . In the extinct woolly mammoth, MT-ND3 would have been essential for energy production, particularly in cold environments where efficient mitochondrial function would be critical for survival.

How does the genomic context of mammoth MT-ND3 differ from modern elephants?

The genomic context of Mammuthus primigenius MT-ND3 exists within a mitochondrial genome that shows several distinct features compared to extant elephants. Research indicates that retroposons, particularly RTE elements, are more abundant in mammoth (~12%) than in the modern elephant genome (~9%) . This difference in genomic architecture may reflect evolutionary adaptations or genetic drift following the divergence of these lineages.

Analysis suggests that RTE activity increased in the proboscidean lineage long before the split between mammoth and elephant, with evidence of a surge of RTE copies showing approximately 11% divergence from consensus sequences . Interestingly, elephants appear to have undergone two rounds of RTE proliferation, occurring at divergence levels of 0.06 and 0.15, which differs from the single major proliferation event observed in mammoth lineages . These genomic differences provide context for understanding the evolutionary pressures that may have shaped the MT-ND3 gene.

What methodologies are recommended for recombinant expression of ancient MT-ND3?

For recombinant expression of ancient MT-ND3 from Mammuthus primigenius, researchers should consider the following methodological approach:

  • Sequence Reconstruction and Verification:

    • Compile multiple sequencing reads from different mammoth specimens to create a consensus sequence

    • Account for potential DNA damage in ancient samples that could lead to an overestimation of substitution rates

    • Validate the sequence through phylogenetic analysis with closely related species

  • Expression System Selection:

    • Use a mammalian expression system (preferably one from a closely related species) for proper post-translational modifications

    • Consider using the Bac-to-Bac expression system with mitochondrial targeting sequences for proper localization

  • Optimized Protocol:

    • Codon optimization for the expression host while maintaining key structural features

    • Inclusion of purification tags that minimally impact protein function

    • Low-temperature expression to improve folding of this highly hydrophobic protein

  • Validation Approaches:

    • Western blotting with antibodies against conserved epitopes

    • Mass spectrometry analysis to confirm primary structure

    • Blue native PAGE to assess integration into Complex I

This methodological framework accounts for the challenges inherent in working with ancient proteins while maximizing the likelihood of successful expression.

What are the key structural characteristics of MT-ND3 relevant to recombinant studies?

MT-ND3 possesses several structural characteristics that researchers should consider when designing recombinant studies:

Structural FeatureCharacteristicRelevance to Recombinant Studies
Molecular WeightApproximately 13 kDa Important for protein detection and purification strategies
Membrane TopologyHighly hydrophobic transmembrane protein Requires specialized detergents and membrane mimetics for solubilization
Functional DomainsCore subunit of Complex I transmembrane region Critical for assessing proper folding and functional reconstitution
Protein-Protein InteractionsInteracts with other Complex I subunitsImportant for studying integration into functional complexes
Post-translational ModificationsMay contain specific modificationsCould impact protein stability and function in recombinant systems

Understanding these structural features is essential for developing appropriate expression, purification, and functional analysis protocols. Researchers should be particularly mindful of the hydrophobic nature of MT-ND3, as this poses significant challenges for recombinant expression and requires specialized approaches for membrane protein handling .

How can researchers confirm the authenticity of reconstructed Mammuthus primigenius MT-ND3 sequences?

Confirming the authenticity of reconstructed Mammuthus primigenius MT-ND3 sequences requires a multifaceted approach:

  • Comparative Sequence Analysis:

    • Perform phylogenetic analyses with sequences from closely related species, particularly Elephantidae

    • Expect that the mammoth MT-ND3 sequence would branch with Elephas maximus (Asian elephant) as its closest relative

    • Look for expected sequence conservation in functional domains

  • Ancient DNA Authentication Criteria:

    • Assess DNA damage patterns characteristic of ancient DNA (C→T and G→A transitions at fragment ends)

    • Evaluate the impact of sequencing errors or DNA damage that could lead to an overestimation of substitution rate

    • Use multiple, independent specimens to generate consensus sequences

  • Functional Domain Conservation:

    • Confirm conservation of key amino acids essential for electron transfer

    • Verify that divergent sites are biologically plausible given the protein's function

    • Assess whether amino acid changes align with cold-climate adaptations

  • Molecular Clock Validation:

    • Calculate whether the observed sequence divergence is consistent with estimated mammoth-elephant divergence times

    • Verify that the rate of synonymous vs. non-synonymous substitutions follows expected patterns

This systematic authentication process helps ensure that the reconstructed sequence genuinely represents Mammuthus primigenius MT-ND3 rather than contaminant DNA or sequence artifacts from ancient DNA damage.

What challenges exist in functional reconstitution of recombinant Mammuthus primigenius MT-ND3 in vitro?

Functional reconstitution of recombinant Mammuthus primigenius MT-ND3 faces several significant challenges:

  • Complex Integration Requirements:

    • MT-ND3 functions as part of Complex I, which requires precise integration with multiple other subunits

    • Research indicates that Complex I and Complex III combine in a 1:1 molar ratio to form NADH-cytochrome c oxidoreductase

    • Reconstitution must account for these higher-order structural requirements

  • Membrane Environment:

    • MT-ND3 is one of the most hydrophobic subunits in the transmembrane region

    • The phospholipid composition of the membrane is crucial for enzyme activity, with evidence pointing to a dual phospholipid requirement for proper function

    • Recreating the appropriate lipid environment for an extinct species presents additional challenges

  • Cofactor Requirements:

    • Complete functional reconstitution requires proper incorporation of all electron-carrying cofactors

    • The ubiquinone pool behavior must be restored to achieve proper electron transfer

    • Activation energy measurements suggest specific structural features promote oxidoreduction of endogenous ubiquinone-10

  • Methodological Approach to Overcome These Challenges:

    • Use nanodiscs or liposomes with defined lipid compositions to create an appropriate membrane environment

    • Co-express multiple mammoth mitochondrial subunits to facilitate proper complex assembly

    • Employ low-temperature expression systems to improve folding of hydrophobic membrane proteins

    • Use rotenone and antimycin inhibition assays to verify proper electron transfer pathways

Successful reconstitution requires addressing these challenges systematically while incorporating knowledge of Complex I-Complex III interactions observed in extant species.

What insights can functional studies of recombinant Mammuthus primigenius MT-ND3 provide about cold adaptation mechanisms?

Functional studies of recombinant Mammuthus primigenius MT-ND3 can yield significant insights into cold adaptation mechanisms through several methodological approaches:

  • Thermal Stability Analyses:

    • Comparative thermal denaturation studies between mammoth and elephant MT-ND3

    • Assessment of protein function across temperature ranges (5-40°C)

    • Identification of structural features that may confer cold tolerance

  • Membrane Fluidity Adaptations:

    • Analysis of protein function in membrane environments with different lipid compositions

    • Testing protein activity in membranes with varying cholesterol content to mimic cold adaptation

    • Evaluation of protein-lipid interactions at low temperatures

  • Electron Transfer Kinetics:

    • Measurement of electron transfer rates at different temperatures

    • Comparative analysis of activation energies between mammoth and elephant proteins

    • Research on modern complexes indicates that structural features affect activation energies for ubiquinone oxidoreduction

  • Proton-Pumping Efficiency:

    • Assessment of the coupling between electron transfer and proton pumping at low temperatures

    • Identification of potentially modified proton channels in the mammoth protein

    • Comparison of proton/electron stoichiometry across temperature ranges

The data from these studies can be organized as follows:

ParameterMethodological ApproachExpected Cold Adaptations
Thermal StabilityDifferential scanning calorimetryLower temperature optimum, broader stability range
Membrane InteractionsFluorescence anisotropy, EPR studiesModified hydrophobic interfaces to function in stiffer membranes
Electron TransferTemperature-dependent kinetic measurementsLower activation energy for electron transfer
Proton PumpingpH-sensitive fluorophores, SFXM techniquesMaintained proton pumping efficiency at lower temperatures

These multiparameter analyses provide a comprehensive picture of how MT-ND3 may have contributed to the woolly mammoth's adaptation to cold environments.

How can researchers address the challenges of ancient DNA damage when expressing recombinant Mammuthus primigenius proteins?

Ancient DNA damage presents significant challenges for accurate recombinant protein expression that researchers must methodically address:

  • Common Ancient DNA Damage Patterns:

    • C→T and G→A transitions, particularly at fragment ends

    • DNA fragmentation limiting complete gene recovery

    • Cross-linking and other miscoding lesions

    • Research on mammoth samples has indicated that sequencing errors or DNA damage could lead to an overestimation of substitution rates, though at very low levels

  • Consensus Sequence Generation:

    • Compile multiple sequencing reads from different specimens and extraction methods

    • Apply statistical models that account for damage patterns

    • Use maximum likelihood approaches to determine the most probable sequence

  • Comparative Genomics Validation:

    • Compare putative mammoth MT-ND3 sequences with those from closely related species

    • Identify highly conserved regions unlikely to have undergone substantial changes

    • Utilize phylogenetic analyses to confirm evolutionary relationships align with expectations

  • Experimental Verification Strategies:

    • Express multiple variant constructs representing alternative sequence interpretations

    • Conduct functional assays to identify biologically plausible sequences

    • Use site-directed mutagenesis to test the impact of ambiguous positions

  • Methodological Protocol for Damage Mitigation:

    • Enzymatic treatment of ancient DNA with uracil-DNA glycosylase before amplification

    • Use of high-fidelity polymerases with proofreading capabilities

    • Deep sequencing approaches to identify consensus sequences

    • Application of predictive algorithms to identify and correct damage-induced errors

By systematically implementing these methodological approaches, researchers can significantly improve the accuracy of recombinant Mammuthus primigenius MT-ND3 expression despite the inherent challenges of ancient DNA damage.

What techniques are most effective for studying protein-protein interactions of recombinant Mammuthus primigenius MT-ND3?

Studying protein-protein interactions of recombinant Mammuthus primigenius MT-ND3 requires specialized techniques appropriate for hydrophobic membrane proteins:

  • Cross-linking Mass Spectrometry (XL-MS):

    • Apply chemical cross-linkers that capture transient interactions

    • Analyze cross-linked peptides using high-resolution mass spectrometry

    • Identify interaction interfaces between MT-ND3 and other Complex I subunits

    • This technique is particularly valuable for membrane proteins that resist crystallization

  • Blue Native PAGE and Co-immunoprecipitation:

    • Use digitonin or other mild detergents to solubilize intact complexes

    • Apply antibodies against MT-ND3 for immunoprecipitation studies

    • Research indicates that antibody dilutions of 1:1000 for Western blotting and 1:200 for immunoprecipitation are effective for human MT-ND3

    • Analyze co-precipitating proteins by mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Create fusion constructs with fluorescent proteins or tags

    • Measure energy transfer between labeled proteins to detect interactions

    • Perform acceptor photobleaching to confirm specific interactions

  • Cryo-Electron Microscopy:

    • Express mammoth MT-ND3 in the context of the entire Complex I

    • Use single-particle analysis to determine structural arrangement

    • Compare with structures from extant species to identify unique features

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map protein interaction surfaces through changes in hydrogen-deuterium exchange rates

    • Identify regions of MT-ND3 protected by binding partners

    • Compare mammoth and elephant proteins to detect evolutionary differences in interaction interfaces

The following table summarizes the experimental conditions for optimal results:

TechniqueOptimal ConditionsExpected OutcomesKey Considerations
XL-MSMild cross-linkers (DSS, BS3), 30 min reactionIdentification of spatial proximity between subunitsRequires comprehensive database of mammoth proteins
Co-IPAntibody dilution 1:200, digitonin solubilization Detection of stable interaction partnersMay require antibodies against conserved epitopes
FRETN-terminal or C-terminal tagging, expression in mammalian cellsReal-time interaction dynamicsTag placement must not disrupt membrane insertion
Cryo-EMPurified complexes at 2-5 mg/ml, vitrification at -180°C3D structural model of mammoth Complex IRequires expression of multiple subunits
HDX-MSD2O labeling at various time points (10s to 1h)Identification of binding interfacesRequires optimization for membrane proteins

These methodological approaches, when systematically applied, provide comprehensive insights into the protein-protein interaction network of recombinant Mammuthus primigenius MT-ND3 within the context of mitochondrial respiratory complexes.

How does the nucleoid organization of MT-ND3 in Mammuthus primigenius compare to modern elephants?

Understanding the nucleoid organization of MT-ND3 in Mammuthus primigenius requires comparative analysis with extant relatives while considering the broader context of mitochondrial genome organization:

Mitochondrial nucleoids are dynamic complexes consisting of multiple copies of mtDNA and key maintenance proteins . The organization of MT-ND3 within these structures in Mammuthus primigenius can be investigated through several methodological approaches:

  • Comparative Analysis of mtDNA-Protein Associations:

    • Ancient DNA techniques can identify protein footprints that may be preserved

    • Nucleoid-associated proteins like TFAM, Twinkle, and mtSSB leave characteristic binding patterns

    • Modern elephant nucleoid structures can serve as reference models

  • Replication Origin Proximity Analysis:

    • The location of MT-ND3 relative to replication origins may influence its expression and mutation rate

    • Recent research has questioned the traditional strand-displacement model of mtDNA replication

    • Evidence now suggests multiple modes of replication may occur, including a more conventional mechanism with coordinated leading-lagging strand synthesis

    • Proximity to D-loop origins of replication could influence MT-ND3 stability and evolutionary rate

  • Experimental Reconstruction Approaches:

    • Recombinant expression of mammoth nucleoid proteins with mammoth mtDNA fragments

    • Super-resolution microscopy to visualize reconstituted nucleoid structures

    • Comparison of protein-DNA interaction patterns between mammoth and elephant sequences

The proximity of MT-ND3 to regulatory elements within the mitochondrial genome may have influenced its evolutionary trajectory in cold-adapted mammoths. Systematic comparative analysis can reveal how nucleoid structure potentially contributed to the functional adaptation of MT-ND3 in the mammoth lineage.

What evolutionary insights can be gained from comparing Mammuthus primigenius MT-ND3 with other extinct and extant Proboscideans?

Evolutionary analysis of Mammuthus primigenius MT-ND3 across Proboscideans provides important insights into adaptive changes and conservation patterns:

  • Phylogenetic Reconstruction Methodology:

    • Generate multiple sequence alignments of MT-ND3 from:

      • Extinct taxa: Mammuthus primigenius, Mammuthus columbi, Palaeoloxodon antiquus

      • Extant taxa: Elephas maximus (Asian elephant), Loxodonta africana (African elephant)

      • Outgroups: Dugong, manatee (Sirenia)

    • Apply maximum likelihood and Bayesian inference methods

    • Test alternative evolutionary models (site-heterogeneous vs. site-homogeneous)

  • Selection Analysis Techniques:

    • Calculate dN/dS ratios across the Proboscidean phylogeny

    • Identify sites under positive selection using branch-site models

    • Test for convergent evolution in cold-adapted lineages

    • Compare with other mitochondrially-encoded Complex I genes

  • Structural Mapping of Evolutionary Changes:

    • Map amino acid substitutions onto predicted MT-ND3 structure

    • Identify clustering of changes in functional domains or protein-protein interfaces

    • Correlate changes with environmental adaptations

Research data indicates that the mammoth genome has several unique features compared to elephants, including differences in transposable element content, with RTEs being more abundant in mammoth (~12%) than in elephant (~9%) . This genomic context may have influenced the evolutionary trajectory of mitochondrial genes like MT-ND3.

The timing of evolutionary events is also informative - RTE activity appears to have surged in the proboscidean lineage before the split of mammoth and elephant, with elephants potentially experiencing two rounds of RTE proliferation compared to one in mammoths . This differential genomic evolution provides context for understanding selection pressures on mitochondrial genes.

How can researchers optimize expression systems for producing functional recombinant Mammuthus primigenius MT-ND3?

Optimizing expression systems for functional recombinant Mammuthus primigenius MT-ND3 requires addressing the unique challenges of ancient mitochondrial membrane proteins:

  • Expression System Selection and Optimization:

Expression SystemAdvantagesDisadvantagesOptimization Strategy
Bacterial (E. coli)High yield, simple cultivationLacks mitochondrial-specific chaperonesUse specialized strains (C41/C43), low temperature (16°C)
Yeast (S. cerevisiae)Eukaryotic processing, mitochondrial importLower yield than bacteriaUse strong inducible promoters, optimize codon usage
Mammalian (HEK293, CHO)Native-like folding and processingHigh cost, lower yieldUse tetracycline-inducible systems, optimize transfection
Insect (Sf9, Hi5)High yield of membrane proteinsGlycosylation differs from mammalsOptimize baculovirus MOI, harvest timing
  • Vector Design Considerations:

    • Include mitochondrial targeting sequences for proper localization

    • Add purification tags that minimize interference with function

    • Incorporate TEV protease sites for tag removal

    • Design codon-optimized sequences accounting for expression host preferences

  • Membrane Integration Strategies:

    • Co-express with mitochondrial chaperones

    • Include phospholipids in purification buffers to maintain stability

    • Research indicates that a dual phospholipid requirement exists for proper enzyme activity

    • Utilize nanodiscs or liposomes for functional reconstitution

  • Functional Validation Approach:

    • Develop electron transfer assays using NADH and artificial electron acceptors

    • Create chimeric constructs with well-characterized portions from modern species

    • Establish Complex I assembly assays using blue native electrophoresis

    • Apply inhibitor sensitivity tests (rotenone) to confirm proper folding

These methodological strategies must be systematically tested and optimized for the specific challenges of Mammuthus primigenius MT-ND3, with particular attention to maintaining the structural integrity required for proper integration into Complex I and subsequent electron transfer functionality.

What methods are most effective for detecting subtle functional differences between recombinant Mammuthus primigenius MT-ND3 and elephant homologs?

Detecting subtle functional differences between recombinant Mammuthus primigenius MT-ND3 and elephant homologs requires sensitive methodological approaches:

  • Enzyme Kinetics at Varying Temperatures:

    • Measure Km and Vmax parameters across temperature ranges (0-40°C)

    • Determine Arrhenius activation energies for NADH oxidation

    • Research indicates that structural features of respiratory complexes promote oxidoreduction of endogenous ubiquinone-10 with specific activation energy signatures

    • Plot temperature-activity profiles to identify optimum temperatures and thermal stability differences

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Monitor iron-sulfur cluster reduction kinetics in reconstructed complexes

    • Measure subtle differences in electron transfer rates and pathways

    • Detect conformational changes upon substrate binding

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Map protein dynamics and solvent accessibility

    • Identify regions with differential flexibility between mammoth and elephant proteins

    • Correlate with potential cold adaptations

  • Electrophysiological Approaches:

    • Reconstitute proteins in liposomes or planar lipid bilayers

    • Measure proton pumping efficiency using pH-sensitive fluorophores

    • Compare ion conductance properties

  • Inhibitor Sensitivity Profiling:

    • Generate dose-response curves for Complex I inhibitors (rotenone, piericidin A)

    • Assess sensitivity to temperature-dependent inhibition

    • Research shows that inhibition patterns can reveal specific electron transfer pathways

The data can be analyzed using the following statistical approaches:

Analysis MethodApplicationExpected Insights
Two-way ANOVATemperature × Species interaction effectsIdentify temperature ranges where functional differences emerge
Principal Component AnalysisMultiparameter functional profilingDiscover patterns of functional divergence across conditions
Thermal Shift AnalysisProtein stability across temperaturesDetect subtle differences in thermal stability profiles
Michaelis-Menten KineticsSubstrate affinity at different temperaturesIdentify adaptations in catalytic efficiency

These methodological approaches provide a comprehensive analytical framework for detecting even subtle functional differences that may reflect cold adaptation in the mammoth protein compared to its elephant homolog.

How can researchers investigate the potential impact of MT-ND3 variants on Mammuthus primigenius adaptation to extreme environments?

Investigating the potential impact of MT-ND3 variants on Mammuthus primigenius adaptation to extreme environments requires an integrative methodological approach:

  • Population Genomics Analysis:

    • Sequence MT-ND3 from multiple mammoth specimens spanning different time periods and geographical locations

    • Identify patterns of selection and adaptation using population genetic statistics

    • Compare cold-adapted populations with those from more temperate regions

    • Research on mammoth genomics has revealed unique genomic features compared to modern elephants

  • Functional Reconstruction and Testing:

    • Express identified MT-ND3 variants in cellular models

    • Measure mitochondrial function across temperature ranges

    • Test performance under oxidative stress conditions typical of cold environments

    • Assess metabolic flexibility using substrate preference analyses

  • Structural Biology Approaches:

    • Model the impact of amino acid substitutions on protein structure

    • Perform molecular dynamics simulations at different temperatures

    • Identify altered protein-protein interactions within Complex I

    • Map variants to functional domains and membrane interfaces

  • Comparative Analysis with Cold-Adapted Species:

    • Compare mammoth MT-ND3 variants with those from other cold-adapted mammals

    • Identify convergent adaptations across phylogenetically distant species

    • Correlate amino acid properties with environmental temperature

Data from such studies could be presented in a comprehensive analysis table:

MT-ND3 VariantPredicted Structural ImpactFunctional EffectEnvironmental Correlation
Example: A→V at position XIncreased hydrophobicity in transmembrane regionEnhanced membrane stability at low temperaturesFound in specimens from colder regions
Example: T→S at position YModified hydrogen bonding networkAltered electron transfer kineticsTemporal correlation with climate cooling events
Example: L→I at position ZSubtle change in side chain packingMaintained function at broader temperature rangeCommon across cold-adapted mammals

This methodological framework not only identifies MT-ND3 variants but also systematically assesses their functional impacts and potential roles in mammoth adaptation to extreme cold environments. By correlating genomic, structural, and functional data with paleoenvironmental records, researchers can build a comprehensive understanding of how mitochondrial adaptations contributed to mammoth survival in harsh Ice Age conditions.

What are the broader implications of studying recombinant Mammuthus primigenius MT-ND3 for understanding mitochondrial evolution?

The study of recombinant Mammuthus primigenius MT-ND3 offers profound insights into mitochondrial evolution with implications extending beyond paleogenomics. By reconstructing and functionally characterizing this ancient protein, researchers can better understand how mitochondrial adaptations enable survival in extreme environments and how evolutionary processes shape bioenergetic systems.

The comparative analysis between mammoth and elephant mitochondrial genomes reveals unique genomic features, including differences in retroposon content and proliferation patterns . These genomic contexts provide a framework for understanding the selective pressures that shaped mitochondrial proteins like MT-ND3. Furthermore, the functional reconstitution of ancient proteins allows direct testing of evolutionary hypotheses about cold adaptation that would otherwise remain speculative.

The methodological approaches developed for studying recombinant Mammuthus primigenius MT-ND3 also advance our technical capabilities for working with ancient proteins, potentially opening new avenues for investigating other extinct species and their adaptations. These techniques contribute to our understanding of how mitochondrial DNA mutations influence disease in modern species , potentially informing therapeutic approaches for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.