Recombinant Mandrillus sphinx Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Mandrillus sphinx (Mandrill) (Papio sphinx)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGVRCLEVSVPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSTLFI AYYDHAAVLLCLVIFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. This receptor regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MC1R and what is its primary function in Mandrillus sphinx?

MC1R (Melanocortin 1 Receptor) is a seven-pass transmembrane G protein-coupled receptor that controls melanogenesis in mandrills and other mammals. As the receptor protein for melanocyte-stimulating hormone (MSH), it plays a crucial role in determining pigmentation patterns. The MC1R gene is intronless and encodes a receptor that regulates the production of two types of melanin: red pheomelanin and black eumelanin .

In Mandrillus sphinx (mandrill), MC1R functions similarly to other primates, controlling pigment synthesis in melanocytes. When activated by α-MSH (alpha-Melanocyte Stimulating Hormone), the receptor stimulates eumelanin production, leading to darker pigmentation. Research on MC1R across species shows that mutations affecting its function are associated with changes in skin and hair color, with loss-of-function mutations typically leading to increased pheomelanin (red/yellow pigment) production .

How does Mandrillus sphinx MC1R compare structurally to other primate MC1R proteins?

Mandrillus sphinx MC1R shares significant structural homology with other primate MC1R proteins, but exhibits species-specific variations. Comparative analysis with the Golden-headed lion tamarin (Leontopithecus chrysomelas) MC1R reveals similar functional domains characteristic of melanocortin receptors:

SpeciesProtein LengthTransmembrane DomainsKey Functional Regions
Mandrillus sphinx317 amino acids7G-protein coupling, ligand binding, signaling
Leontopithecus chrysomelas310 amino acids7G-protein coupling, ligand binding, signaling
Human317 amino acids7G-protein coupling, ligand binding, signaling

Both mandrill and human MC1R maintain the essential functional architecture of a G-protein coupled receptor with seven transmembrane domains, but differences in specific amino acid residues can affect ligand binding affinity and signaling efficiency. These structural differences provide valuable insights into the evolutionary adaptations of the melanocortin system across primates .

What expression systems are typically used for producing recombinant Mandrillus sphinx MC1R?

Recombinant Mandrillus sphinx MC1R is commonly produced using prokaryotic expression systems, particularly E. coli. This approach allows for high yield production of the protein for research applications. The recombinant protein is typically fused to purification tags, such as His-tag, to facilitate isolation and purification .

Alternative expression systems include:

  • Mammalian cell systems (e.g., HEK293 cells) - Provide proper post-translational modifications

  • Insect cell systems (e.g., Sf9 cells) - Useful for G-protein coupled receptors

  • Yeast expression systems - Balance between prokaryotic yield and eukaryotic processing

The choice of expression system depends on the specific research requirements. For structural studies or antibody production, E. coli-expressed protein may be sufficient, while functional studies often benefit from mammalian expression systems that ensure proper folding and post-translational modifications essential for receptor function .

How can Mandrillus sphinx MC1R be utilized in melanoma research?

Mandrillus sphinx MC1R offers valuable insights for melanoma research due to the established link between MC1R signaling and melanoma development. Researchers can utilize this recombinant protein in several sophisticated experimental approaches:

  • Cell Cycle Regulation Studies: MC1R signaling directly impacts melanoma cell proliferation by delaying progression from G2 into mitosis. Experiments comparing wild-type and mutant MC1R can elucidate mechanisms of growth inhibition. This approach is supported by evidence that MC1R overexpression or activation with MSH results in phosphorylation and inhibition of cdc25B, a cyclin-dependent kinase 1-activating phosphatase .

  • Comparative Signaling Analysis: Researchers can investigate how Mandrillus sphinx MC1R signaling differs from human MC1R variants associated with melanoma risk. This involves reconstitution experiments in MC1R-null melanoma cell lines, followed by analysis of downstream cAMP signaling pathways .

  • Transcriptome Modulation: Using microarray analysis techniques similar to those employed with human or mouse MC1R, researchers can examine how MC1R activation impacts gene expression profiles. Evidence shows that MC1R ligands like αMSH significantly alter the expression of hundreds of genes, providing insight into protective mechanisms against melanoma development .

  • Evolutionary Medicine Approaches: The mandrill genome contains unique adaptations in immune-related genes that may interact with MC1R signaling pathways. Researchers can explore how these species-specific variations affect melanoma susceptibility and progression through integrated genomic and proteomic approaches .

When designing experiments, researchers should consider using cell synchronization techniques (e.g., thymidine double block) to precisely examine cell cycle effects, and should include appropriate controls for receptor expression levels and ligand specificity .

What methodological approaches are optimal for studying MC1R signaling pathways in Mandrillus sphinx?

Investigating MC1R signaling pathways in Mandrillus sphinx requires specialized methodological approaches:

  • cAMP Measurement Assays: Since MC1R primarily signals through cAMP, researchers should employ sensitive cAMP detection methods such as ELISA-based assays or real-time FRET-based reporters. Time-course experiments capturing both rapid (minutes) and prolonged (hours) cAMP responses are crucial for understanding signaling dynamics .

  • Phosphoproteomic Analysis: To identify downstream targets of MC1R activation, researchers should implement phosphoproteomic approaches focusing on specific phosphorylation events, particularly those affecting cell cycle regulators like cdc25B (at serine 323). This requires:

    • Immunoprecipitation with phospho-specific antibodies

    • Mass spectrometry analysis of phosphopeptides

    • Western blotting validation with phospho-specific antibodies

  • Transcriptome Profiling: Gene expression analysis using RNA-Seq or microarray approaches can identify target genes regulated by MC1R signaling. Time-course experiments (3 hours to 4 days post-stimulation) with multiple replicates (minimum 6 per time point) are recommended based on previous successful studies .

  • Receptor Mutagenesis: Creating specific mutations in Mandrillus sphinx MC1R based on known human variants allows for functional comparison. This should be coupled with receptor expression assays and signaling readouts to determine how structural differences affect function .

For all these approaches, appropriate controls are essential, including untreated cells, cells expressing vector-only constructs, and treatments with receptor antagonists. Statistical analysis should account for time-dependent changes and multiple comparisons across experimental conditions .

How do ligand binding properties of Mandrillus sphinx MC1R compare to human MC1R variants?

The ligand binding properties of Mandrillus sphinx MC1R compared to human MC1R variants reveal important structural and functional differences relevant to evolutionary adaptation and potential therapeutic applications:

  • Ligand Affinity Profiles: While specific binding constants for Mandrillus sphinx MC1R have not been fully characterized, comparative analyses can be performed using:

    • Radioligand binding assays with labeled α-MSH

    • Competition binding assays with various MC1R ligands including α-MSH, ACTH fragments, and synthetic agonists/antagonists

    • Functional dose-response curves measuring cAMP production

  • Species-Specific Response Patterns: Evidence from other mammalian MC1R studies suggests that species-specific variations in the transmembrane domains and extracellular loops significantly affect ligand recognition and binding affinity. For instance, mutations in the human MC1R transmembrane regions alter response to α-MSH, and similar structural differences may exist in the mandrill receptor .

  • Antagonist Sensitivity: The agouti signaling protein (ASP) acts as an inverse agonist of MC1R in many mammals. Comparative studies show that ASP and α-MSH have opposing effects on gene expression, with ASP treatment resulting in alteration of 1,487 unique probes compared to 255 for α-MSH treatment. This differential response pattern likely extends to Mandrillus sphinx MC1R and should be experimentally verified .

The methodology for comparing ligand properties should include:

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • FRET-based assays to detect conformational changes upon ligand binding

  • Downstream signaling assays using reporter constructs

What are the evolutionary implications of MC1R variation between Mandrillus sphinx and other primates?

The evolutionary implications of MC1R variation between Mandrillus sphinx and other primates provide significant insights into adaptive pigmentation and potential disease susceptibility:

  • Adaptive Pigmentation Evolution: MC1R variations across primates reflect adaptation to different environmental pressures. In mandrills, which display striking facial and genital coloration, MC1R likely played a crucial role in the evolution of these social signaling features. Comparative analysis with other primates reveals how natural and sexual selection have shaped MC1R function across different ecological niches .

  • Genomic Context: The mandrill genome shows unique adaptations, including expansion of olfactory receptor genes and modifications in immune-related genes. MC1R should be analyzed within this broader genomic context, particularly examining:

    • Regulatory regions that control MC1R expression

    • Potential epistatic interactions with other pigmentation genes

    • Co-evolution with genes involved in visual perception (relevant for species with color-based social signaling)

  • Disease Susceptibility Divergence: Human MC1R variants are strongly associated with melanoma risk. Comparative analysis of Mandrillus sphinx MC1R may reveal protective mechanisms that evolved in response to different UV exposure patterns. The mandrill genome contains 17 genes with disease-related mutations, and examining potential interactions with MC1R pathways could provide valuable insights into differential disease susceptibility .

  • Methodology for Evolutionary Analysis: Researchers should employ:

    • Phylogenetic analysis of MC1R sequences across primates

    • Selection pressure analysis (dN/dS ratios) to identify positively selected residues

    • Functional characterization of ancestrally reconstructed MC1R variants

    • Population genetics approaches to understand within-species variation

The evolution of MC1R in mandrills represents a fascinating model for understanding how a single receptor can influence both physiological functions (UV protection) and social signaling (colorful displays), with potential implications for human skin biology and disease .

What are the optimal experimental conditions for studying Mandrillus sphinx MC1R activation?

Optimizing experimental conditions for studying Mandrillus sphinx MC1R activation requires careful consideration of multiple parameters:

  • Receptor Expression Systems:

    • For transient expression: Mammalian cell lines (HEK293, COS-7) transfected with MC1R expression constructs provide a clean background for signaling studies

    • For stable expression: Inducible expression systems (e.g., Tet-On) allow controlled receptor levels, similar to the GFP-MC1R inducible system used in MM485 cells

    • For endogenous context: Melanocyte cell lines transfected with Mandrillus sphinx MC1R constructs offer physiologically relevant cellular machinery

  • Ligand Stimulation Parameters:

    • Concentration range: Typically 10⁻¹⁰ to 10⁻⁶ M of α-MSH for dose-response curves

    • Time-course: Short-term (minutes to hours) for signaling studies; longer periods (hours to days) for transcriptional and phenotypic changes

    • Culture conditions: Serum starvation (0.1-0.5% serum) for 12-24 hours before stimulation reduces background signaling

  • Readout Methodologies:

    • Immediate signaling: cAMP assays (ELISA or FRET-based) with measurements at 5, 15, 30, and 60 minutes post-stimulation

    • Cell cycle effects: Synchronized cells (thymidine double block) with flow cytometry analysis at 4, 8, 12, and 24 hours

    • Transcriptional effects: RNA isolation at 3 hours, 1 day, 2 days, 3 days, and 4 days post-stimulation

  • Essential Controls:

    • Vehicle-treated cells (matched solvent conditions)

    • Cells expressing vector-only constructs

    • Stimulation with unrelated GPCR ligands to confirm specificity

    • Inclusion of MC1R antagonists to block specific signaling

When designing experiments, researchers should account for receptor internalization and desensitization, which typically occur after prolonged agonist exposure, by including appropriate time points and using pulse-chase experimental designs when necessary .

How can researchers effectively compare signaling pathways between Mandrillus sphinx MC1R and human MC1R variants?

To effectively compare signaling pathways between Mandrillus sphinx MC1R and human MC1R variants, researchers should implement a comprehensive experimental strategy:

  • Matched Expression Systems:

    • Use identical promoters, expression vectors, and host cell lines for both receptors

    • Quantify receptor expression by Western blotting and cell surface ELISA to ensure comparable levels

    • Consider bicistronic vectors with fluorescent markers to normalize for transfection efficiency

  • Parallel Signaling Analysis:

    • Primary pathway: Measure cAMP production using identical assay conditions and time points

    • Secondary pathways: Assess MAPK activation, calcium mobilization, and β-arrestin recruitment

    • Downstream targets: Monitor phosphorylation of cdc25B and other cell cycle regulators

  • Transcriptional Profiling Approach:

    • Conduct RNA-Seq or microarray analysis of cells expressing either receptor under identical stimulation conditions

    • Apply principal component analysis (PCA) and heat map clustering to identify similarities and differences in gene expression patterns

    • Focus on genes differentially regulated between the two receptor systems

  • Molecular Dynamics and Structural Biology:

    • Generate homology models of both receptors

    • Perform molecular dynamics simulations to identify structural differences that may impact signaling

    • Use chimeric receptors (swapping domains between human and mandrill MC1R) to pinpoint regions responsible for signaling differences

  • Quantitative Comparison Framework:

    • Calculate EC₅₀ values for agonist-induced cAMP production

    • Determine time constants for receptor activation, desensitization, and internalization

    • Measure relative activation of different downstream pathways using pathway-specific reporter constructs

This approach allows for direct, quantitative comparison between the two receptor systems, highlighting both conserved signaling mechanisms and species-specific adaptations that may have evolved in response to different selective pressures .

What are common challenges when working with recombinant Mandrillus sphinx MC1R and how can they be addressed?

Working with recombinant Mandrillus sphinx MC1R presents several technical challenges that researchers should anticipate and address:

  • Protein Stability Issues:

    • Challenge: G-protein coupled receptors like MC1R are prone to denaturation and aggregation during purification and storage.

    • Solution: Add stabilizing agents such as glycerol (50% final concentration) to storage buffer. Store at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles. For working solutions, maintain at 4°C for no more than one week .

  • Low Expression Yields:

    • Challenge: Transmembrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression system; consider fusion tags that enhance solubility; explore different expression systems (bacterial, insect, mammalian) to determine optimal conditions for your specific application .

  • Functional Validation:

    • Challenge: Confirming that recombinant MC1R retains native conformation and functionality.

    • Solution: Implement ligand binding assays with radiolabeled α-MSH; verify cAMP signaling in reconstituted systems; use conformation-specific antibodies to confirm proper folding .

  • Receptor Internalization and Trafficking:

    • Challenge: Upon activation, MC1R undergoes internalization, complicating signaling studies.

    • Solution: Include endocytosis inhibitors in acute signaling studies; use fluorescently tagged MC1R to monitor trafficking; implement pulse-chase experimental designs .

  • Species-Specific Pharmacology:

    • Challenge: Ligands optimized for human MC1R may have different potencies at Mandrillus sphinx MC1R.

    • Solution: Generate comprehensive dose-response curves for all ligands; consider using species-specific ligands when available; implement structure-activity relationship studies to identify optimal ligands .

  • Background Signaling in Host Cells:

    • Challenge: Endogenous melanocortin receptors or related GPCRs in host cells can confound results.

    • Solution: Select receptor-negative cell lines (confirmed by RT-PCR); use receptor-selective ligands; include appropriate negative controls (untransfected cells, vector-only controls) .

By anticipating these challenges and implementing appropriate solutions, researchers can maximize the reliability and reproducibility of their experiments with recombinant Mandrillus sphinx MC1R .

How can researchers distinguish between MC1R-specific effects and non-specific effects in experimental systems?

Distinguishing between MC1R-specific effects and non-specific effects requires rigorous experimental design and appropriate controls:

  • Pharmacological Validation:

    • Employ concentration-dependent response curves with selective MC1R agonists (α-MSH) and antagonists

    • Compare responses to structurally diverse MC1R ligands that should converge on the same signaling pathway if receptor-specific

    • Use ligands for other melanocortin receptors (MC3R, MC4R) as specificity controls

  • Genetic Approaches:

    • Implement siRNA or CRISPR-based knockdown/knockout of MC1R to confirm loss of response

    • Use site-directed mutagenesis to create signaling-deficient MC1R variants that should eliminate specific responses

    • Complement MC1R-deficient systems with wild-type receptor to restore responsiveness

  • Pathway Validation:

    • Block downstream signaling components (e.g., adenylyl cyclase inhibitors for cAMP pathway)

    • Use pathway-specific inhibitors to dissect MC1R-initiated signaling from convergent pathways

    • Examine temporal relationships between MC1R activation and downstream effects

  • Experimental Controls:

    • Include vehicle controls matched precisely to ligand preparation

    • For cell cycle studies, implement thymidine double block synchronization in all experimental groups

    • Use cells expressing related GPCRs as specificity controls

  • Statistical Rigor:

    • Perform adequate biological replicates (minimum n=6 for microarray studies)

    • Apply appropriate statistical tests with corrections for multiple comparisons

    • Implement blinded analysis where possible to reduce bias

A systematic approach combining these strategies can effectively distinguish MC1R-specific signaling events from non-specific or off-target effects, enhancing the reliability and reproducibility of research findings with Mandrillus sphinx MC1R .

What emerging technologies might enhance Mandrillus sphinx MC1R research?

Several cutting-edge technologies are poised to revolutionize research on Mandrillus sphinx MC1R:

  • Cryo-EM for Structural Analysis:

    • High-resolution structural determination of MC1R in different conformational states

    • Visualization of ligand-receptor complexes without crystallization

    • Comparison of structural differences between mandrill and human MC1R variants

  • CRISPR-Cas9 Gene Editing:

    • Generation of isogenic cell lines with mandrill MC1R replacing human MC1R

    • Introduction of specific mutations to study structure-function relationships

    • Development of MC1R reporter systems with endogenous tagging

  • Single-Cell Transcriptomics:

    • Analysis of heterogeneous responses to MC1R activation in melanocyte populations

    • Identification of cell subpopulations with distinct signaling characteristics

    • Integration with spatial transcriptomics to understand tissue-specific responses

  • Optogenetics and Chemogenetics:

    • Development of light-activated or designer drug-activated MC1R variants

    • Precise temporal control of receptor activation in specific cell populations

    • Dissection of rapid versus sustained signaling consequences

  • Organoid and 3D Culture Systems:

    • Study of MC1R function in physiologically relevant three-dimensional contexts

    • Co-culture systems to examine melanocyte-keratinocyte interactions

    • Patient-derived organoids for translational applications

  • Computational Approaches:

    • Molecular dynamics simulations of receptor-ligand interactions

    • Systems biology modeling of MC1R signaling networks

    • Machine learning algorithms for predicting functional consequences of MC1R variants

  • In vivo Imaging Technologies:

    • Development of MC1R-specific PET or SPECT tracers

    • Intravital microscopy to monitor MC1R trafficking and signaling

    • Whole-animal imaging to track melanocyte behavior following MC1R activation

These emerging technologies will provide unprecedented insights into the structural, functional, and evolutionary aspects of Mandrillus sphinx MC1R, potentially leading to novel applications in comparative physiology, evolutionary biology, and translational medicine .

How might comparative studies between Mandrillus sphinx MC1R and human MC1R contribute to melanoma research?

Comparative studies between Mandrillus sphinx MC1R and human MC1R offer unique opportunities to advance melanoma research through evolutionary insights:

  • Natural Resistance Mechanisms:

    • Mandrills have evolved under different UV exposure patterns than humans, potentially developing unique protective mechanisms

    • Comparative signaling studies may reveal how mandrill MC1R activation differs from human variants associated with melanoma risk

    • Identification of species-specific downstream pathways could uncover novel protective mechanisms against melanoma development

  • Cell Cycle Regulation Differences:

    • MC1R activation inhibits melanoma proliferation by delaying G2/M transition through cdc25B phosphorylation

    • Comparative analysis may reveal whether mandrill MC1R exerts stronger anti-proliferative effects than human variants

    • Understanding species differences in cell cycle regulation could identify new therapeutic targets

  • Transcriptional Response Patterns:

    • Human MC1R variants differ in their transcriptional responses to ligands

    • Comparing gene expression profiles between species after MC1R activation may identify critical protective genes present in mandrill responses but absent in high-risk human variants

    • Such genes could represent novel therapeutic targets or biomarkers

  • DNA Damage Response Integration:

    • MC1R signaling interacts with DNA damage response pathways

    • Comparative studies may reveal species-specific differences in how MC1R activation modulates UV-induced DNA damage repair

    • These insights could lead to novel photoprotective strategies for high-risk individuals

  • Evolutionary Medicine Applications:

    • Identifying positively selected residues in mandrill MC1R that confer enhanced protection

    • Engineering human MC1R variants with mandrill-specific features to enhance protective signaling

    • Developing peptide or small molecule drugs that mimic mandrill-specific MC1R activation patterns

  • Methodological Approach:

    • Generate chimeric receptors swapping domains between human and mandrill MC1R

    • Compare downstream signaling, transcriptional responses, and anti-proliferative effects

    • Identify critical regions that confer enhanced protection against melanoma development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.