Recombinant Manduca sexta Diuretic hormone receptor

Shipped with Ice Packs
In Stock

Description

Functional Expression Systems

Mas-DH-R has been successfully expressed in multiple recombinant systems, each offering distinct advantages:

Expression SystemReceptor YieldFunctional Activity
Sf9 cells (baculovirus)77 pmol/mg protein High cAMP stimulation upon Mas-DH binding; retains native ligand affinity
COS-7 cells1.3 pmol/mg protein Binds Mas-DH and related insect DHs (e.g., Acheta domesticus DH) with high affinity
E. coliNot quantified Produces full-length receptor for structural studies; purity >90% via SDS-PAGE

Baculovirus-driven expression in Sf9 cells yields the highest receptor density, making it optimal for pharmacological studies . In contrast, E. coli-expressed receptors are used for bulk production and biophysical characterization .

Ligand Binding and Activation Mechanism

Mas-DH-R binds the 41-amino-acid amidated peptide Mas-DH (Manduca sexta Diuretic Hormone) to regulate fluid secretion via cAMP signaling:

  • Binding Affinity: Mas-DH binds with high affinity (low nM range), comparable to native receptors in Malpighian tubules .

  • Structure-Activity Relationship: Truncated analogs (e.g., [13-41] Mas-DH) retain binding capacity but fail to activate cAMP synthesis, implicating the N-terminal region in receptor activation .

  • Cross-Species Reactivity: The receptor is selectively activated by Mas-DH, with minimal response to DHs from Acheta domesticus or Locusta migratoria .

Insect Control Agent Development

Mas-DH-R is a target for designing insecticides that disrupt fluid homeostasis in pests. Its homology to vertebrate corticotropin-releasing factor (CRF) receptors allows comparative studies to identify species-specific agonists/antagonists .

Signal Transduction Studies

The receptor’s cAMP-dependent activation mechanism provides a model for understanding GPCR signaling in insects. Key findings include:

  • Metabolism: Mas-DH is degraded by Malpighian tubule enzymes, modulating hormone bioavailability .

  • Receptor Homology: Shares 38% sequence identity with human CRF receptors, highlighting evolutionary conservation .

Future Directions

Current research focuses on:

  1. Structural Elucidation: X-ray crystallography of E. coli-expressed receptors to map ligand-binding pockets.

  2. High-Throughput Screening: Using Sf9-expressed receptors to identify novel insecticides .

  3. Evolutionary Studies: Comparing Mas-DH-R with CRF-family receptors in other insects and vertebrates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Diuretic hormone receptor; DH-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Target Protein Sequence
MAEECLARKFNLSDNYCPAYFDGLLCWDPTPWNTLAVQKCFKELYGIQYDDTQNASRLCL DGVWHNYTNYTNCTERIANGSPTDVASLIYLAGYSLSLAVLSLAVFVFLYFKDLRCLRNT IHTNLMSTYILSACSWILNLVLQNWSDESQQDQTSCMILVICMNYFYLTNFFWMLVEGLY LYMLVVETFTAENIKLKVYTTIGWGAPAVFITIWVISRCFVNVLPSTGPDGLAMFPEAKM CIWMHEHQVDWIHKAPALVGLALNLFFLIRIMWVLITKLRSANTLETEQYRKATKALLVL IPLLGITNLLVLCGPSDDSWFAYAFDYTRALMLSTQGFTVALFYCFMNTEVRHAIRYHVE RWKTGRTIGGGRRRGASYSKDWSPRSRTESIRLTV
Uniprot No.

Target Background

Function
This receptor acts as a mediator for the insect diuretic hormone. Its activity is facilitated by G proteins that activate adenylyl cyclase.
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in Malpighian tubules.

Q&A

Basic Research Questions

  • What is the Manduca sexta Diuretic Hormone Receptor?

The Manduca sexta Diuretic Hormone Receptor (DH-R) is a G protein-coupled receptor that belongs to the calcitonin/secretin receptor family . This 395-amino acid protein plays a crucial role in regulating water and salt balance in the tobacco hornworm (Manduca sexta) . The receptor functions by binding to its cognate ligand, Manduca diuresin (MD), a 30-amino acid peptide, which subsequently activates intracellular signaling cascades, particularly cAMP synthesis . This signaling pathway ultimately regulates diuresis and osmoregulation in the insect, making it an important component of physiological homeostasis.

  • What expression systems have been successfully used for producing recombinant Manduca sexta DH-R?

Multiple heterologous expression systems have been employed to produce functional recombinant Manduca sexta DH-R, each with distinct advantages:

Expression SystemExpression LevelAdvantages
Sf9 cells (baculovirus)77 pmol/mg proteinHigh expression, post-translational modifications
Malpighian tubules (native)3.1 pmol/mg proteinNative environment, natural folding
Transfected COS-7 cells1.3 pmol/mg proteinMammalian processing capabilities
E. coliNot specified in dataCost-effective, high yield potential

The baculovirus expression system using Spodoptera frugiperda (Sf9) cells provides significantly higher expression levels compared to native tissues or mammalian cell systems . E. coli expression systems have also been successfully employed to produce full-length receptor with N-terminal His-tags, offering a more economical approach for large-scale production .

  • What structural characteristics have been identified for the recombinant Manduca sexta DH-R?

Chemical crosslinking studies with 125I-labeled Manduca diuretic hormone (Mas-DH) have revealed that the expressed receptor has a molecular weight of approximately 48-52 kDa . The full-length receptor consists of 395 amino acids with the complete sequence identified and available (UniProt ID: P35464) . The protein contains multiple transmembrane domains characteristic of G protein-coupled receptors, with important functional regions in both the N-terminal and C-terminal portions . When expressed in E. coli, the recombinant protein demonstrates high purity (>90% as determined by SDS-PAGE), making it suitable for various research applications .

Advanced Research Questions

  • How does the structure-function relationship of Manduca diuretic hormone inform receptor activation mechanisms?

Structure-function studies of Manduca diuretic hormone have revealed critical insights into receptor activation mechanisms. Particularly significant is the finding that the N-terminal truncated analog [13-41] Mas-DH binds to the expressed receptor with high affinity but fails to stimulate cAMP synthesis . This observation demonstrates a clear functional separation between ligand binding and receptor activation, suggesting that while the C-terminal portion of the hormone is sufficient for receptor recognition and binding, the N-terminal region (amino acids 1-12) is specifically required for triggering the conformational changes necessary for G-protein coupling and subsequent signal transduction . This two-step mechanism provides valuable information for understanding the molecular basis of receptor activation and offers potential targets for the development of receptor agonists or antagonists.

  • What methodological approaches can researchers use to assess the functional activity of recombinant Manduca sexta DH-R?

Researchers can employ several complementary approaches to evaluate the functional activity of recombinant Manduca sexta DH-R:

Assay TypeMeasurementSignificance
Ligand bindingAffinity for diuretic hormoneConfirms receptor binding pocket functionality
cAMP productionStimulation of cAMP synthesisValidates G-protein coupling and signaling activation
Chemical crosslinkingMolecular weight confirmationVerifies receptor structural integrity
Truncated ligand responseDifferential activationIdentifies domains required for receptor activation

The baculovirus expression system has proven particularly valuable for functional studies as it produces receptor that not only binds the ligand but also couples to adenylyl cyclase, allowing for assessment of the complete signaling pathway . Comparative studies with truncated hormone analogs can further elucidate the structural requirements for receptor activation versus binding .

  • What are the optimal conditions for expressing and maintaining functional recombinant Manduca sexta DH-R?

For successful expression and maintenance of functional recombinant Manduca sexta DH-R, researchers should consider the following methodology:

For baculovirus expression systems:

  • Monitor time-dependent expression as receptor levels increase over time post-infection in Sf9 cells

  • Harvest at optimal time points to maximize functional receptor yield

For E. coli expression systems:

  • Express as a fusion protein with an N-terminal His-tag to facilitate purification

  • Purify to >90% purity using appropriate chromatography techniques

For storage and handling of purified receptor:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage

  • Store working aliquots at 4°C for no more than one week to maintain functionality

  • Avoid repeated freeze-thaw cycles which compromise receptor integrity

  • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 as an optimal storage buffer

These conditions help maintain the structural integrity and functional activity of the receptor protein.

  • How do functional studies of recombinant Manduca diuresin (MD) contribute to understanding receptor pharmacology?

Functional studies of recombinant Manduca diuresin have provided critical insights into receptor pharmacology. When expressed in E. coli, recombinant MD was resolved by reverse-phase HPLC into three peptide groups with different retention times, which mass spectrometry identified as MD deletants missing various lengths of the C-terminus . Despite these C-terminal truncations and the absence of an amidated C-terminus (which is present in the native hormone), these recombinant variants maintained biological activity . This surprising finding strongly indicates that the N-terminal portion of MD is the primary determinant of biological activity, while the C-terminus may play a secondary role in receptor interaction . These observations align with studies of the receptor showing that N-terminal truncated analogs bind but don't activate the receptor . Together, these complementary approaches reveal a complex pharmacological profile where different regions of the ligand mediate distinct aspects of receptor interaction and activation.

  • What challenges exist in producing stable and functional recombinant Manduca sexta DH-R, and how can they be addressed?

Producing stable and functional recombinant Manduca sexta DH-R presents several challenges that researchers must address:

Challenge: Maintaining proper protein folding, especially of transmembrane domains
Solution: Selection of appropriate expression systems such as baculovirus-infected Sf9 cells that provide eukaryotic folding machinery

Challenge: Protein stability during storage
Solution: Implementation of specific storage conditions including: lyophilization, storage at -20°C/-80°C, addition of 5-50% glycerol, and use of Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Challenge: Preventing activity loss from freeze-thaw cycles
Solution: Preparing single-use aliquots and storing working solutions at 4°C for up to one week

Challenge: Achieving high expression levels
Solution: Optimizing expression systems (baculovirus systems have achieved 77 pmol/mg protein compared to 3.1 pmol/mg in native tissues)

Challenge: Verifying functional activity
Solution: Employing multiple complementary assays including ligand binding studies and cAMP production assays

These methodological approaches help overcome the inherent difficulties in working with membrane-bound G protein-coupled receptors.

  • How can structure-function studies of the Manduca sexta DH-R inform insect endocrinology research and potential applications?

Structure-function studies of the Manduca sexta DH-R provide valuable insights that extend beyond this specific system to broader applications in insect endocrinology. The finding that the N-terminal region of Manduca diuresin is required for receptor activation but not binding suggests a two-step activation mechanism that may be conserved across related peptide hormone receptors . This mechanistic understanding can inform the design of specific agonists or antagonists that selectively modulate receptor function.

The high expression levels achieved in heterologous systems (particularly 77 pmol/mg protein in Sf9 cells compared to 3.1 pmol/mg in native tissues) demonstrate the feasibility of producing sufficient quantities of receptor for structural characterization . Such structural insights could facilitate comparative studies across insect species, potentially revealing conserved mechanisms of hormone action and species-specific adaptations in water regulation systems. Additionally, understanding the molecular basis of diuretic hormone signaling in insects may ultimately contribute to the development of novel, environmentally friendly pest management strategies that specifically target water balance mechanisms in agricultural pests.

  • What approaches can be used to study receptor-ligand interactions for the Manduca sexta diuretic hormone system?

Several methodological approaches can be employed to investigate receptor-ligand interactions in the Manduca sexta diuretic hormone system:

Chemical crosslinking with labeled ligand: 125I-labeled Mas-DH has been successfully used to identify receptor proteins of 48-52 kDa through crosslinking studies . This approach helps confirm the molecular weight of the receptor and verify ligand binding.

Truncation studies: Comparing the binding and activation properties of truncated hormone analogs, such as [13-41] Mas-DH, has revealed that while the N-terminal region is dispensable for binding, it is essential for receptor activation . Similarly, studies with recombinant MD deletants missing portions of the C-terminus have shown that these variants remain biologically active, confirming the critical role of the N-terminus in receptor activation .

cAMP production assays: Measuring cAMP synthesis following receptor stimulation provides a functional readout of G-protein coupling and signal transduction . This approach can quantitatively assess the efficacy of different ligand variants.

Comparative expression systems: Expressing the receptor in different systems (Sf9 cells, COS-7 cells, E. coli) allows for comparison of receptor properties in different cellular environments and can help identify system-specific effects on receptor function .

These complementary approaches provide a comprehensive toolkit for dissecting the molecular details of receptor-ligand interactions in this important physiological system.

  • How does the recombinant Manduca sexta diuretic hormone receptor compare with receptors from other insect species?

While the search results don't provide extensive comparative data across species, references to related studies in other insects such as Bombyx mori and Acheta domesticus suggest conservation of key features among insect diuretic hormone receptors . All these receptors belong to the calcitonin/secretin receptor family, indicating evolutionary conservation of core structural and functional properties.

The Manduca sexta DH-R has been expressed at particularly high levels in the baculovirus expression system (77 pmol/mg protein), which exceeds the expression levels reported for the native receptor in Malpighian tubules (3.1 pmol/mg) . This suggests that the recombinant expression system might serve as an effective platform for comparative studies of diuretic hormone receptors from multiple insect species.

The finding that the N-terminal region of Manduca diuresin is critical for receptor activation but not binding may represent a conserved mechanism across species . Further comparative studies would be valuable to determine whether this two-step activation mechanism is a universal feature of insect diuretic hormone signaling or if species-specific variations exist. Such information would contribute to our understanding of the evolution of neuroendocrine signaling systems in insects.

  • What future research directions could enhance our understanding of the Manduca sexta diuretic hormone receptor system?

Several promising research directions could advance our understanding of the Manduca sexta diuretic hormone receptor system:

Structure determination: The high expression levels achieved in heterologous systems (particularly in Sf9 cells) open the possibility for structural studies using techniques such as X-ray crystallography or cryo-electron microscopy . Structural insights would significantly enhance our understanding of ligand binding and activation mechanisms.

Detailed structure-activity relationship studies: Building on the observation that the N-terminal region of the hormone is critical for receptor activation, more fine-grained analysis of which specific amino acids mediate this effect could provide molecular-level insights into receptor activation .

Investigation of downstream signaling pathways: While cAMP production has been established as a key signaling output, a more comprehensive characterization of additional signaling pathways and their physiological consequences would enhance our understanding of receptor function in vivo .

Development of receptor-specific modulators: Based on the structure-function insights, designing selective agonists or antagonists that specifically target different aspects of receptor function (binding versus activation) could provide valuable tools for further research and potential applications in pest management.

Comparative studies across developmental stages: Investigating how receptor expression and function change throughout the life cycle of Manduca sexta could reveal important developmental regulation of water balance systems in insects.

These research directions would build upon the solid foundation established by current studies and expand our understanding of this physiologically important signaling system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.