Recombinant Manduca sexta V-type proton ATPase 16 kDa proteolipid subunit (VHA16)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Manduca sexta V-type proton ATPase 16 kDa proteolipid subunit (VHA16) is a key component of vacuolar ATPases (V-ATPases), essential for proton transport across cellular membranes. Produced via heterologous expression in E. coli, this recombinant protein includes a full-length sequence (1-156 amino acids) fused to an N-terminal His tag for purification .

Comparative Genomics

SpeciesGene LocusFunction
Manduca sextaVha16V-ATPase proton channel; gap junction ductin
Drosophila melanogasterVha16Rescues yeast V-ATPase mutants
Saccharomyces cerevisiaeVMA3Orthologous proteolipid subunit

V-ATPase Activity

VHA16 is indispensable for V-ATPase assembly, which acidifies organelles and powers ion transport in insect epithelia (e.g., midgut and Malpighian tubules) . In Manduca larvae, this enzyme generates transepithelial potentials exceeding 150 mV, enabling nutrient absorption .

Gap Junction Regulation

As ductin, VHA16 forms connexon channels facilitating intercellular communication. This dual role was confirmed via:

  • N-terminal sequencing of Manduca gap junction proteins .

  • Functional rescue experiments in yeast using Drosophila Vha16 cDNA .

Biochemical Studies

  • Protein-Protein Interactions: Used to map binding interfaces within V-ATPase complexes .

  • Structural Biology: Serves as a model for cryo-EM studies due to its conserved transmembrane domains .

Genetic and Pharmacological Tools

  • Gene Knockout Models: Drosophila P-element insertions in Vha16 enable studies of null phenotypes .

  • Insecticide Development: Targeting VHA16 disrupts pH homeostasis in pest insects like Manduca .

Expression Analysis

  • Transcript Variants: Northern blots detect 1.4 kb and 1.9 kb mRNAs in Manduca midgut .

  • Conservation: 98% amino acid identity with Drosophila Vha16, underscoring evolutionary stability .

Functional Assays

Assay TypeResult
Yeast ComplementationDrosophila Vha16 rescues S. cerevisiae VMA3 mutants
SDS-PAGESingle band at ~16 kDa confirms purity and monodispersity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
VHA16; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Target Names
VHA16
Target Protein Sequence
MAENPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG IIAIYGLVVAVLIAGSLDSPSNNYTLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTKQ
Uniprot No.

Target Background

Function

The 16 kDa proteolipid subunit (VHA16) is a proton-conducting pore-forming subunit of the membrane-integral V0 complex within the vacuolar ATPase (V-ATPase). V-ATPase is crucial for acidifying various intracellular compartments in eukaryotic cells. It powers electrophoretic K+/2H+ antiport by generating a transmembrane voltage exceeding 200 mV.

Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the structural organization and function of VHA16 within the V-ATPase complex?

VHA16 (subunit c) is a critical component of the V0 domain of the V-ATPase complex in Manduca sexta. The V-ATPase consists of two main domains: the V1 domain responsible for ATP hydrolysis and the V0 domain responsible for proton translocation across membranes. VHA16 forms part of the membrane-embedded c-ring in the V0 domain that is primarily responsible for proton translocation .

The complex structure of the V-ATPase has been revealed through single-particle cryo-EM and negative staining studies of M. sexta and yeast complexes. These structural analyses show that the V-ATPase has a 3-stator network linked by a collar of density formed by the C, H, and a subunits. ATP hydrolysis within the catalytic AB domains causes rotation of the central rotor axle (formed by F, D, and d subunits), which drives the movement of the c-subunit barrel past the a subunit, facilitating proton transport across the membrane .

What expression patterns does VHA16 show during different developmental stages of Manduca sexta?

VHA16 expression patterns correlate with the developmental stages of M. sexta, which has a short life cycle lasting about 30-50 days . Expression levels fluctuate particularly during key developmental transitions such as larval-larval molts and metamorphosis. During the final larval instar, expression changes correspond to the critical weight threshold (approximately 5.3g), which triggers physiological changes related to metamorphosis .

Analysis of RNA-seq data from various tissues and developmental stages shows tissue-specific expression patterns, with particularly high expression in tissues associated with ion regulation and acid-base balance. This data is available in the M. sexta Official Gene Set v2.0, which comprises 15,451 protein-coding genes .

What are the recommended methods for recombinant expression and purification of Manduca sexta VHA16?

Recommended Expression Systems:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, cost-effectiveMay require codon optimization for insect protein
Insect cell lines (Sf9, Hi5)Better post-translational modificationsHigher cost, longer production time
Yeast (S. cerevisiae)Functional complementation possibleModerate yield

Purification Protocol Overview:

  • Cell lysis using detergent-based methods (e.g., 1% DDM or CHAPS)

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography to separate monomeric from oligomeric forms

  • Ion exchange chromatography for final polishing

For functional studies, reconstitution into liposomes is recommended using a lipid composition mimicking the native environment of M. sexta membranes .

What evidence supports the dual function of VHA16 in both V-ATPase and gap junctions in Manduca sexta?

Research has revealed that the 16 kDa proteolipid (subunit c) of the V-ATPase in M. sexta is homologous to the ductin polypeptide that forms connexon channels in gap junctions. Studies have identified that the major protein component of M. sexta gap junction preparations is a 16 kDa polypeptide with an N-terminal sequence identical to the deduced sequence of a previously cloned cDNA from Manduca .

Comparative analysis between M. sexta and Drosophila melanogaster provides further evidence. A Drosophila cDNA highly homologous to the Manduca cDNA can rescue Saccharomyces cerevisiae defective in V-ATPase function when the corresponding yeast gene (VMA3) has been inactivated. Evidence from these cross-species functional studies suggests that in both Drosophila and Manduca, the same polypeptide serves as both the proteolipid subunit c component of the V-ATPase and the ductin component of gap junctions .

This dual functionality may have evolutionary significance, potentially representing an ancient protein repurposing event that contributed to the development of complex cellular communication in insects.

How can RNA interference be effectively designed to study VHA16 function in Manduca sexta?

RNA interference (RNAi) has been successfully employed to study V-ATPase function in M. sexta. For effective VHA16 knockdown, researchers should consider:

RNAi Design Parameters:

ParameterRecommendationRationale
dsRNA length300-500 bpOptimal for cellular uptake while maintaining specificity
Target regionAvoid transmembrane domainsBetter accessibility for RISC complex
ControlGFP dsRNANon-specific control to account for RNAi machinery effects
Delivery methodDirect feeding or injectionDepends on developmental stage

Experimental Protocol Overview:

  • Design dsRNA targeting conserved regions of VHA16 mRNA

  • Synthesize dsRNA using in vitro transcription

  • Administer to second instar larvae via droplet-feeding method

  • Monitor survival rates and phenotypic changes

  • Confirm knockdown efficiency via qRT-PCR at day 3 post-treatment

Studies have shown that targeting V-ATPase subunits in M. sexta can significantly affect larval survival. In one study, larvae fed with dsRNA targeting V-ATPaseA showed significantly reduced survival rates compared to control groups over a 7-day period, with confirmed knockdown of target gene expression .

How does VHA16 contribute to Manduca sexta's tolerance to plant allelochemicals like nicotine?

M. sexta larvae feed on solanaceous plants containing allelochemicals such as nicotine, and the V-ATPase system plays a crucial role in detoxification mechanisms. The VHA16 subunit contributes to this process in several ways:

  • The V-ATPase complex acidifies cellular compartments necessary for detoxification processes

  • VHA16, as part of the proton-translocating machinery, helps maintain pH gradients required for sequestration of toxins

  • The function of VHA16 may be modulated in response to nicotine exposure

Research has demonstrated that M. sexta has mechanisms for selectively sequestering and secreting nicotine present in tobacco plants . Contrary to typical detoxification mechanisms where glycosidases in the insect gut cleave sugar molecules from glycosylated toxins to release the active toxin, M. sexta has evolved a surprising adaptation. A specific defensive compound called lyciumoside IV from the host plant Nicotiana attenuata is actually toxic with sugar molecules bound to it. Glycosidases in the M. sexta midgut remove only one sugar molecule from lyciumoside IV, converting it to a non-toxic form .

This selective deglycosylation represents an important counter-adaptation by the insect to plant defenses, and the V-ATPase system likely contributes to this process by maintaining the appropriate pH environment for these specialized enzymes to function optimally.

What population-level variation exists in VHA16 across different geographical populations of Manduca sexta?

Recent genomic studies have identified distinct genetic differences among North American populations of M. sexta from Arizona, Kansas, and North Carolina. While specific variations in VHA16 have not been directly characterized, the genomic landscape shows:

  • Arizona populations are particularly differentiated from Kansas and North Carolina populations

  • Two likely segregating inversions exist in the Arizona population, including an 8 Mb inversion on chromosome 12 and another on the Z chromosome

  • These structural variations may influence adaptation to local host plants and environmental conditions

The genetic differentiation potentially impacts the expression and function of critical proteins like VHA16. Researchers investigating VHA16 should consider these population-level differences when designing experiments and interpreting results, especially when studying aspects related to host plant adaptation or environmental stress responses.

How does overexpression or knockdown of VHA16 affect V-ATPase assembly and cellular physiology?

Experimental manipulation of VHA16 expression has significant effects on V-ATPase assembly and function:

Overexpression Effects:

  • Enhanced levels of V0 components when regulatory C subunit (Vha44) is overexpressed, as demonstrated by increased Vha16-1-GFP levels in studies using GFP insertion in the genomic locus

  • Potential increased pump assembly when regulatory elements are upregulated

  • Possible compensation through downregulation of other components, such as VhaSFD (H subunit), which normally inhibits ATP hydrolysis of unassembled V1 sector

Knockdown Effects:

  • Severely compromised survival in larval stages

  • Disruption of proton gradients across cellular membranes

  • Impaired cellular functions dependent on vesicular acidification

  • Potential developmental arrests at critical stages

These findings highlight the essential nature of VHA16 in cellular physiology and development of M. sexta and provide important considerations for experimental design when manipulating this crucial component of the V-ATPase complex.

What are the key considerations for designing antibodies against Manduca sexta VHA16 for immunological studies?

When designing antibodies against M. sexta VHA16 for immunolocalization or protein quantification, researchers should consider:

  • Target epitope selection:

    • Choose regions with low sequence conservation across other V-ATPase subunits

    • Avoid transmembrane domains, which have poor antigenicity

    • Consider exposed loops or termini based on structural predictions

  • Cross-reactivity assessment:

    • Validate against recombinant VHA16 from M. sexta

    • Test against homologous proteins from related species to establish specificity

    • Use Western blotting with tissue extracts to confirm single-band detection

  • Application-specific considerations:

    • For immunohistochemistry, optimize fixation protocols to preserve epitope accessibility

    • For immunoprecipitation, select epitopes that remain accessible in native conditions

    • For quantitative assays, establish standard curves using purified recombinant protein

What experimental approaches can resolve the dual functionality of VHA16 in V-ATPase and gap junctions?

To investigate the proposed dual function of VHA16, consider these methodological approaches:

Biochemical Separation Techniques:

  • Differential centrifugation to isolate membrane fractions

  • Immunoprecipitation with V-ATPase-specific versus gap junction-specific antibodies

  • Blue native PAGE to separate intact complexes

Imaging Approaches:

  • Super-resolution microscopy to visualize co-localization patterns

  • FRET analysis to determine protein-protein interactions

  • Correlative light and electron microscopy for ultrastructural context

Functional Assays:

  • Electrophysiological measurements of gap junction conductance

  • Proton transport assays in reconstituted proteoliposomes

  • Dual-function rescue experiments in knockout models

Combining these approaches can provide compelling evidence regarding the proposed dual functionality and help elucidate the molecular mechanisms that allow a single protein to perform two distinct cellular roles.

How can genomic editing techniques be applied to study VHA16 function in Manduca sexta?

CRISPR/Cas9 and related genomic editing techniques present powerful opportunities for studying VHA16 function in M. sexta. The Drosophila Vha16 gene structure, with its intron/exon arrangement identical to that of a human Vha16 gene, provides guidance for targeting strategies . Consider these approaches:

  • Gene knockout studies:

    • Complete knockout may be lethal; consider conditional approaches

    • Pilot studies indicate P-elements can be easily inserted into the Drosophila ductin Vha16 gene , suggesting similar approaches may work in M. sexta

  • Reporter gene insertion:

    • GFP tagging at the C-terminus has been successful in related systems

    • Allows for real-time visualization of protein localization and dynamics

  • Point mutations for structure-function analysis:

    • Target specific residues in transmembrane domains or ATP binding sites

    • Use homology modeling based on solved structures to guide mutation design

  • Tissue-specific or inducible systems:

    • Develop GAL4-UAS or similar systems adapted for M. sexta

    • Enable temporal control using heat shock or drug-inducible promoters

These genomic approaches, combined with the available genomic resources such as the Official Gene Set v2.2 for M. sexta , provide powerful tools for dissecting VHA16 function in this important model organism.

How can Manduca sexta VHA16 research inform agricultural pest management strategies?

Research on M. sexta VHA16 has significant implications for developing targeted pest control strategies:

  • RNA interference approaches:

    • dsRNA targeting VHA16 has shown significant effects on larval survival

    • Potential for development of species-specific biopesticides

    • Consideration of delivery methods through transgenic plants or sprays

  • Population-specific targeting:

    • Genomic variations across populations may affect susceptibility to VHA16-targeted interventions

    • Design of population-specific control measures based on genetic differences

  • Resistance management:

    • Understanding detoxification mechanisms involving V-ATPase can inform strategies to overcome pesticide resistance

    • Development of compounds that could interfere with V-ATPase function specifically in pest species

What insights can comparative studies between Manduca sexta VHA16 and human V-ATPase components provide for biomedical research?

Comparative analysis between M. sexta VHA16 and human V-ATPase components offers valuable insights for biomedical research:

  • Evolutionary conservation:

    • The intron/exon structure of the Drosophila Vha16 gene is identical to that of a human Vha16 gene

    • This conservation suggests fundamental functional importance across diverse taxa

  • Structural insights:

    • The large size of M. sexta makes it suitable for medical imaging modalities (CT, MRI, PET)

    • Structural studies of M. sexta V-ATPase provide templates for understanding human counterparts

  • Disease relevance:

    • V-ATPase dysfunction in humans is associated with various diseases

    • M. sexta as a model for studying V-ATPase-related pathologies

    • Potential for drug discovery targeting conserved functional domains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.