Recombinant Manihot esculenta Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Manihot esculenta Apocytochrome f (petA)

Recombinant Manihot esculenta Apocytochrome f (petA) refers to a form of the apocytochrome f protein, which is produced through recombinant DNA technology using Manihot esculenta (cassava) as the source organism. Cytochrome f is a crucial component of the cytochrome b6f complex found in the thylakoid membranes of chloroplasts, playing a vital role in photosynthetic electron transfer between Photosystem II and Photosystem I . The 'petA' gene encodes apocytochrome f, the precursor protein that, once processed and matured, becomes the functional cytochrome f .

Production of Recombinant Apocytochrome f (petA)

Recombinant production involves using genetic engineering techniques to express the petA gene in a host organism. For example, Escherichia coli can be used as an in vitro expression system to produce recombinant Lactuca sativa Apocytochrome f (petA) . The process typically includes:

  1. Gene Cloning: Isolating the petA gene from Manihot esculenta .

  2. Vector Construction: Inserting the gene into an expression vector suitable for the host organism .

  3. Transformation: Introducing the vector into the host cells .

  4. Expression: Culturing the host cells under conditions that promote gene expression .

  5. Purification: Isolating and purifying the recombinant protein from the host cell lysate .

Applications in Research

Recombinant Apocytochrome f (petA) is valuable in various research areas:

  • Protein Structure and Function Studies: Recombinant proteins allow researchers to study the structure, function, and interactions of cytochrome f without the need to extract it directly from plant tissues .

  • Biochemical Assays: Recombinant cytochrome f can be used in in vitro assays to study electron transfer rates, redox properties, and interactions with other components of the photosynthetic pathway .

  • Genetic Engineering: Understanding the petA gene and its product can aid in efforts to genetically engineer plants with improved photosynthetic efficiency .

Research Findings

Research on Manihot esculenta has led to the isolation of various chemical constituents, including maniesculentins A and B, which were found to have antibacterial activity . Although these compounds are not directly related to Apocytochrome f (petA), this demonstrates the research potential of Manihot esculenta in the field of biochemistry .

Table: Impact of RNA Editing on Chloroplast Function

GeneProteinFunctionImpact of Editing Deficiency
petBCytochrome b6 subunit of the cytochrome b6f complexMediates electron transfer between PSII and PSIReduced photosynthetic efficiency
psbLPSII subunitComponent of Photosystem II, involved in electron transfer and oxygen evolutionImpaired photosynthesis
accDAcetyl-CoA carboxylase subunitInvolved in fatty acid synthesisDisrupted lipid metabolism
psbFPhotosystem II subunit FComponent of Photosystem II, involved in electron transfer and oxygen evolutionReduced PSII efficiency
orrm1ORRM1 controls 62% of chloroplast editing sitesRNA editing factor in chloroplastsPale green phenotype
orrm6ORRM6 is primarily required for editing psbF-C77 and accDRNA editing factor in chloroplastsPale green phenotype
YLGmORRM1Chloroplast RNA editingChanged multiple chloroplast RNA editing sites, yellow leaves, and abnormal photosynthesis at seedling stage

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Manihot esculenta (Cassava) (Jatropha manihot)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKMGNLSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPAAKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASEGRQVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) in Manihot esculenta and what is its biological significance?

Apocytochrome f (petA) is a critical component of the photosynthetic electron transport chain in Manihot esculenta. The protein is encoded by the plastid gene petA and functions as part of the cytochrome b6f complex, which mediates electron transfer between Photosystem II and Photosystem I during photosynthesis. The mature protein spans amino acids 36-320 of the full-length sequence .

In cassava, this protein plays an essential role in energy metabolism, contributing to the plant's ability to grow in various eco-geographical environments. The functional protein contains a covalently attached heme group, which facilitates electron transfer through the reduction and oxidation of its iron atom. The apocytochrome form refers to the protein prior to heme incorporation. Understanding this protein's structure and function can provide insights into cassava's metabolic adaptation strategies across different environments .

What expression systems are most efficient for producing recombinant Manihot esculenta Apocytochrome f?

E. coli is the predominant expression system used for producing recombinant Manihot esculenta Apocytochrome f (petA). This heterologous expression system offers several advantages including:

  • High protein yield through optimized codon usage

  • Simplified purification using affinity tags (commonly His-tags)

  • Cost-effective production scale

  • Well-established protocols for induction and harvest

Commercial preparations typically express the protein with an N-terminal His-tag in E. coli systems to facilitate purification via metal affinity chromatography . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli

  • Inclusion of appropriate affinity tags (His, GST, etc.)

  • Signal peptide removal (using only residues 36-320)

  • Expression temperature optimization (typically lower temperatures of 16-25°C to improve folding)

  • Induction conditions (IPTG concentration and induction timing)

While E. coli remains the standard system, eukaryotic expression in yeast or insect cells may offer advantages for certain functional studies where post-translational modifications might be important .

What are the optimal storage and handling conditions for maintaining recombinant Apocytochrome f stability?

Proper storage and handling of recombinant Apocytochrome f is critical for maintaining protein integrity and experimental reproducibility. Based on established protocols, the following conditions are recommended:

Storage FormTemperatureBuffer ConditionsAdditional Recommendations
Long-term-20°C to -80°CTris-based buffer with 50% glycerolAliquot to avoid freeze-thaw cycles
Working stock4°CSame as storage bufferUse within one week
Lyophilized-20°CN/AReconstitute in deionized water to 0.1-1.0 mg/mL

Critical handling recommendations:

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • After reconstitution of lyophilized protein, add glycerol to a final concentration of 5-50% before aliquoting for long-term storage

  • Store working aliquots at 4°C for no more than one week to maintain activity

Stability indicators should be monitored periodically, including SDS-PAGE analysis to confirm the absence of degradation products and activity assays when applicable.

What structural analysis techniques are most effective for characterizing recombinant Manihot esculenta Apocytochrome f?

Multiple complementary structural analysis techniques provide comprehensive characterization of recombinant Apocytochrome f:

  • X-ray Crystallography: Provides high-resolution structural details of the protein, particularly the positioning of the heme-binding site and interaction surfaces. Requires highly purified protein samples (>95% purity) and optimization of crystallization conditions.

  • Circular Dichroism (CD) Spectroscopy: Useful for analyzing secondary structure content (α-helices, β-sheets) and monitoring structural changes under different conditions. The CD spectrum between 190-260 nm can be deconvoluted to estimate secondary structure proportions.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Enables analysis of protein dynamics and local structure in solution. Particularly valuable for examining heme-protein interactions and conformational changes during electron transfer.

  • Mass Spectrometry: Essential for confirming protein mass, sequence verification, and identifying post-translational modifications or proteolytic processing events.

  • Cryo-Electron Microscopy: Particularly useful for visualizing Apocytochrome f in the context of larger photosynthetic complexes.

Methodological approach should include initial characterization using CD and mass spectrometry for quality control, followed by higher-resolution techniques for detailed structural analysis. For functional studies, combining structural information with spectroscopic measurements of the heme environment provides crucial insights into electron transfer mechanisms .

How can site-directed mutagenesis be applied to study specific functional domains within Apocytochrome f?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in Apocytochrome f. Key domains that warrant investigation include:

  • Heme-binding domain: The sequence "CANCHLA" contains the cysteine residue that covalently attaches to the heme group. Mutations at position C37 completely disrupt heme attachment, while mutations of surrounding residues can alter redox potential.

  • Electron transfer pathway: Residues along the electron transfer path can be systematically mutated to probe the mechanism. Important targets include:

    • H25 and R156 (potential electron transfer mediators)

    • Y1, Y9, and F4 (aromatic residues potentially involved in π-stacking)

  • Protein-protein interaction surfaces: Mutations at the lumen-facing surface can disrupt interactions with plastocyanin or other electron transfer partners.

Methodological approach:

  • Use QuikChange or Q5 site-directed mutagenesis protocols on expression plasmids

  • Express mutant proteins under identical conditions as wild-type

  • Conduct parallel purification and characterization to enable direct comparisons

  • Employ laser flash photolysis or stopped-flow spectroscopy to measure electron transfer rates in wild-type versus mutant proteins

  • Perform binding assays with interaction partners to quantify effects on complex formation

Correlation of structural perturbations with functional changes requires careful controls, including verification that mutations do not cause global protein misfolding .

What purification strategies yield the highest purity of recombinant Apocytochrome f from E. coli expression systems?

Purification of recombinant Apocytochrome f from E. coli requires a multi-step strategy to achieve high purity while maintaining structural integrity:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is highly effective for His-tagged preparations. Recommended binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole. Elute with increasing imidazole gradient (50-250 mM).

  • Intermediate Purification: Ion exchange chromatography using either:

    • Anion exchange (Q-Sepharose) at pH 8.0 (protein pI ~5.5)

    • Cation exchange (SP-Sepharose) at pH 5.0

  • Polishing Step: Size exclusion chromatography (Superdex 75/200) to remove aggregates and achieve final purity >90%.

  • Optional Steps:

    • Tag removal using TEV or thrombin protease if tag-free protein is required

    • Endotoxin removal for cell-based applications

Optimization considerations:

  • Include reducing agents (0.5-1 mM DTT or 2-5 mM β-mercaptoethanol) to prevent oxidation

  • Add glycerol (10%) to stabilize protein during purification

  • Maintain temperature at 4°C throughout purification process

  • Consider detergent addition (0.05% DDM or 0.1% Triton X-100) if hydrophobic regions cause aggregation

The final product should be assessed for purity using SDS-PAGE (expect >90% purity), with secondary validation by mass spectrometry to confirm correct molecular weight and absence of truncations .

What spectroscopic methods can effectively assess the functional integrity of recombinant Apocytochrome f?

Several spectroscopic techniques can be employed to assess the functional integrity of recombinant Apocytochrome f, focusing on both structural integrity and the properties of the heme cofactor:

  • UV-Visible Spectroscopy: The most direct method for assessing heme incorporation and redox state.

    • Oxidized cytochrome f: Strong Soret band at ~410 nm and α/β bands at ~555 nm and ~525 nm

    • Reduced cytochrome f: Shift in Soret band to ~415 nm and intensified α/β bands

    • The ratio of Soret band to 280 nm absorbance indicates heme occupancy

    • Redox difference spectra (reduced minus oxidized) can quantify functional cytochrome content

  • Fluorescence Spectroscopy: Tryptophan fluorescence can indicate proper folding and heme proximity (heme quenches tryptophan fluorescence).

  • Circular Dichroism: Assesses secondary structure integrity in the far-UV region (190-250 nm).

  • Electron Paramagnetic Resonance (EPR): Provides detailed information about the heme iron environment in the oxidized state.

  • Redox Potentiometry: Determines the midpoint potential of the heme group, which should be approximately +350 mV for functional cytochrome f.

Experimental protocol for functional assessment:

  • Record UV-Visible spectrum of purified protein (2-10 μM)

  • Add reducing agent (sodium dithionite) and record spectrum again

  • Calculate difference spectrum to quantify reducible cytochrome content

  • Compare spectral characteristics and redox potential with native protein standards

These methods collectively provide a comprehensive assessment of both structural integrity and electron transfer capability .

How does Apocytochrome f research contribute to understanding cassava's adaptation to diverse environmental conditions?

Research on Apocytochrome f contributes significantly to understanding cassava's remarkable environmental adaptability through several key mechanisms:

  • Photosynthetic efficiency regulation: As a crucial component of the electron transport chain, Apocytochrome f directly influences photosynthetic efficiency under varying light and temperature conditions. Characterizing its functional properties helps explain cassava's ability to maintain productivity across diverse eco-geographical zones.

  • Metabolic network integration: Studies integrating genomic and metabolomic approaches reveal how photosynthetic efficiency (influenced by cytochrome f function) connects to broader metabolic networks. For example, research shows that cassava accessions from different geographical regions exhibit distinct leaf metabolome profiles that correlate with genotypic clustering, suggesting adaptation to specific environments .

  • Stress response mechanisms: Cytochrome f activity under stress conditions (drought, heat, high light) provides insights into cassava's resilience. The protein's redox state influences retrograde signaling from chloroplast to nucleus, potentially triggering stress-responsive gene expression.

  • Varietal differences: Analysis of sequence variations in petA across cassava varieties can identify functional polymorphisms that contribute to adaptation. These differences may explain why certain varieties perform better in specific environments, as suggested by eco-geographical biome correlations with metabolic profiles .

Research methodologies that connect Apocytochrome f function to environmental adaptation include:

  • Comparative analysis of petA sequences across diverse cassava germplasm

  • Correlation of photosynthetic parameters with metabolomic data

  • Examination of protein-protein interactions within photosynthetic complexes under varying environmental conditions

  • Integration with broader -omics datasets to identify adaptation signatures

This research has direct applications for improving cassava varieties with enhanced environmental resilience, crucial for food security in regions dependent on this staple crop .

What approaches can integrate Apocytochrome f research with broader metabolomic studies in cassava?

Integrating Apocytochrome f research with metabolomic studies provides a systems-level understanding of cassava biology. Several methodological approaches facilitate this integration:

  • Correlation Analysis Framework:

    • Measure Apocytochrome f activity/abundance across diverse cassava accessions

    • Perform untargeted metabolomics on the same samples

    • Identify metabolites that correlate with Apocytochrome f parameters

    • Cluster accessions based on combined protein activity and metabolite profiles

  • Environmental Response Studies:

    • Subject plants to controlled environmental stresses (drought, heat, etc.)

    • Track changes in both Apocytochrome f function and metabolite profiles

    • Identify metabolic shifts that correlate with altered electron transport chain function

    • This approach has revealed that different cassava accessions show distinct metabolomic responses to environmental conditions, as documented in regional varieties

  • Multi-omics Data Integration:

    • Combine transcriptomic data (petA expression levels) with proteomics (Apocytochrome f abundance) and metabolomics

    • Apply network analysis to identify regulatory hubs

    • Use pathway enrichment to identify processes linked to photosynthetic efficiency

  • Tissue-Specific Comparative Analysis:

    • Compare leaf versus root metabolomes in relation to photosynthetic protein function

    • Research shows that while leaf metabolomes correlate with genotypic clustering and eco-geographical adaptation, root metabolomes exhibit different regulatory patterns

    • This suggests tissue-specific metabolism regulation that may be influenced by photosynthetic efficiency

Key methodological considerations include standardized sampling protocols, careful selection of developmental stages, and appropriate statistical approaches for multi-omics data integration. Research has shown that phenylpropanoid and apocarotenoid metabolites may be particularly important in connecting photosynthetic function to stress responses in cassava .

How can researchers effectively compare structural and functional properties of Apocytochrome f across different plant species?

Comparative analysis of Apocytochrome f across plant species provides insights into evolutionary adaptations of photosynthetic systems. A systematic approach includes:

  • Sequence-Structure-Function Analysis Pipeline:

    • Multiple sequence alignment of petA genes and proteins from diverse species

    • Identification of conserved domains versus species-specific variations

    • Homology modeling based on available crystal structures

    • Prediction of functional impacts using in silico approaches

    • Experimental validation of key differences

  • Experimental Comparative Approaches:

    • Heterologous expression of Apocytochrome f from different species under identical conditions

    • Standardized purification and characterization protocols

    • Direct comparison of:

      • Spectroscopic properties (UV-Vis, CD, fluorescence)

      • Redox potentials and electron transfer kinetics

      • Thermal and pH stability profiles

      • Protein-protein interaction specificities

  • Cross-Species Complementation Studies:

    • Expression of Manihot esculenta Apocytochrome f in model systems (Arabidopsis, tobacco)

    • Functional assessment through photosynthetic measurements

    • Comparison with native protein performance

  • Evolutionary Context Analysis:

    • Correlation of sequence differences with environmental adaptation

    • Identification of positions under positive selection

    • Integration with phylogenetic frameworks

A comprehensive comparative analysis should include representatives from diverse plant lineages (monocots, dicots, C3, C4, and CAM plants) to identify adaptations specific to cassava versus those shared with other species adapted to similar environments.

When conducting such analyses, standardized experimental conditions are crucial to ensure that observed differences reflect genuine species-specific adaptations rather than methodological variations .

What are the key considerations when designing antibodies against Manihot esculenta Apocytochrome f for immunoprecipitation studies?

Designing effective antibodies against Manihot esculenta Apocytochrome f requires careful consideration of multiple factors to ensure specificity, sensitivity, and functional utility in immunoprecipitation applications:

  • Epitope Selection Strategy:

    • Analyze sequence uniqueness compared to other cassava proteins

    • Identify surface-exposed regions using structural prediction tools

    • Avoid highly conserved domains if species-specificity is required

    • Consider multiple epitopes from distinct regions:

      • N-terminal domain (residues 40-75)

      • Large domain (residues 76-250)

      • C-terminal anchor region (residues 251-320)

  • Antibody Format Selection:

    • Polyclonal antibodies: Provide recognition of multiple epitopes but may have batch-to-batch variation

    • Monoclonal antibodies: Offer consistency but may be sensitive to epitope modifications

    • Recombinant antibodies: Allow precise engineering of binding properties

  • Production and Validation Protocol:

    • For peptide antibodies:

      • Select 15-20 amino acid peptides with high antigenicity scores

      • Ensure peptides maintain native conformation when conjugated to carrier

    • For recombinant protein immunization:

      • Use highly purified protein to minimize off-target responses

      • Consider both full-length and domain-specific constructs

    • Validation requirements:

      • Western blot against recombinant and native protein

      • Immunoprecipitation efficiency testing

      • Cross-reactivity assessment with related proteins

      • Immunolocalization to confirm subcellular targeting

  • Application-Specific Considerations:

    • For ChIP applications: Target DNA-adjacent regions

    • For co-IP: Avoid epitopes at protein-protein interaction interfaces

    • For immunolocalization: Consider accessibility in fixed tissues

When developing these antibodies, researchers should also validate their performance under conditions that mimic experimental applications, including buffer compositions, detergent concentrations, and fixation protocols that will be used in actual studies .

What emerging technologies could advance Apocytochrome f research in cassava improvement programs?

Several cutting-edge technologies hold promise for transforming Apocytochrome f research and its applications in cassava improvement:

  • CRISPR-Cas9 Gene Editing Applications:

    • Precise modification of petA gene to create variant forms with altered properties

    • Introduction of tagged versions of Apocytochrome f for in vivo tracking

    • Creation of conditional expression systems to study developmental roles

    • Engineering of photosynthetic efficiency through targeted modifications

  • Cryo-EM Technology Integration:

    • High-resolution structural analysis of entire photosynthetic complexes

    • Visualization of dynamic conformational changes during electron transfer

    • Comparative structural biology across cassava varieties with different environmental adaptations

  • Single-Molecule Techniques:

    • FRET-based approaches to monitor protein-protein interactions in real-time

    • Optical tweezers to measure force generation during complex assembly

    • Single-molecule electron transfer kinetics to identify rate-limiting steps

  • Synthetic Biology Approaches:

    • Design of optimized Apocytochrome f variants with enhanced properties

    • Creation of minimal photosynthetic units for fundamental research

    • Development of biosensors based on Apocytochrome f redox properties

  • Multi-omics Integration Platforms:

    • Machine learning approaches to connect genotype, protein function, and phenotype

    • Systems biology models incorporating Apocytochrome f activity with metabolic networks

    • Prediction of photosynthetic performance based on sequence variations across germplasm

These technologies could help address key challenges in cassava research, including:

  • Understanding genotype-environment interactions that determine productivity

  • Developing varieties with improved photosynthetic efficiency under stress conditions

  • Accelerating breeding programs through marker-assisted selection based on functional variants

Implementation challenges include technology accessibility in cassava-growing regions, regulatory considerations for gene-edited crops, and the need for interdisciplinary collaboration between molecular biologists, crop scientists, and computational biologists.

How can researchers effectively integrate Apocytochrome f studies with genetic diversity analyses in cassava breeding programs?

Integrating Apocytochrome f functional studies with genetic diversity analyses provides powerful tools for cassava improvement programs. An effective integration framework includes:

  • Sequence-Function Correlation Methodology:

    • Sequence petA genes from diverse germplasm collections

    • Identify haplotypes and correlate with photosynthetic efficiency parameters

    • Express representative variants and characterize functional differences

    • Develop molecular markers for breeding programs based on functional polymorphisms

  • Genomics-Assisted Breeding Approaches:

    • Utilize DArTSNP markers and similar tools to assess genetic diversity

    • Incorporate petA sequence and functional data into breeding selection criteria

    • Develop breeding values that include photosynthetic efficiency parameters

    • Select parent lines with complementary Apocytochrome f characteristics

  • Environmental Adaptation Analysis:

    • Correlate petA sequence variants with performance in specific environments

    • Identify cassava accessions with petA adaptations to targeted conditions

    • Integrate with broader metabolomic data to understand adaptive mechanisms

    • Design crossing strategies to combine beneficial photosynthetic traits

  • Phenotype Prediction Models:

    • Develop machine learning algorithms that incorporate petA sequence data

    • Train models using historical performance data across environments

    • Validate predictions with field trials of selected varieties

    • Refine models iteratively to improve accuracy

Implementation considerations include:

  • Standardization of phenotyping protocols across diverse environments

  • Development of high-throughput methods for Apocytochrome f functional assessment

  • Collaborative networks spanning molecular biology and field breeding

  • Data management systems that integrate molecular, physiological, and field performance data

These approaches can accelerate cassava improvement by connecting molecular-level understanding of photosynthesis with practical breeding objectives, particularly important given cassava's role in food security across diverse tropical environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.