Recombinant Manihot esculenta Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Manihot esculenta (Cassava) (Jatropha manihot)
Target Names
cemA
Target Protein Sequence
MKKWKKKTFIPLLYLTSIVFLPWWVSFLFNKSLESWIINCCNTSKSETFLNDIQEKSILE KFMELEDLVRLNEIIKEYPETHLQKFRIGIHKETIQLIKMHNEDRIHTILHFSTNIICFI ILSGYSILSNEELIILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVY KDFGFAHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What are the predicted functional domains of cemA in cassava?

The cemA protein contains several notable functional domains:

  • N-terminal transit peptide: Directs the protein to the chloroplast

  • Transmembrane domains: Multiple hydrophobic regions that anchor the protein in the chloroplast envelope membrane

  • Conserved motifs: Several regions showing high conservation across plant species suggesting functional importance

Protein structure prediction tools suggest cemA contains predominantly α-helical transmembrane regions with intervening loop structures. While the precise function remains to be fully characterized in cassava, comparative genomics with other plant chloroplast proteins suggests roles in proton transport, carbon concentration mechanisms, or other membrane transport functions essential for photosynthesis.

How is cemA expression regulated in different cassava tissues?

Based on gene expression atlas data for cassava, cemA shows differential expression across tissue types, with highest expression in photosynthetically active tissues . This pattern is consistent with its role in chloroplast function. The methodology to study this tissue-specific expression includes:

  • RNA extraction from diverse cassava tissues (leaves, stems, storage roots)

  • RT-PCR or RNA-seq analysis using cemA-specific primers

  • Normalization against housekeeping genes (e.g., cassava TAF 15b)

  • Calculation of relative expression using the 2^(-ΔΔCT) method

Expression analyses show that cemA transcription is coordinated with other chloroplast-encoded genes involved in photosynthesis, suggesting co-regulation at the transcriptional level.

What are the optimal conditions for expressing recombinant cemA protein?

Based on established protocols for recombinant chloroplast proteins, the following expression system is recommended:

ParameterOptimal Condition
Expression SystemE. coli (BL21 DE3 or Rosetta strains)
Expression VectorpET series with N-terminal His-tag
Induction0.5-1.0 mM IPTG at OD600 0.6-0.8
Temperature18-20°C for 16-18 hours (reduced temperature improves folding)
Media2XYT or TB supplemented with appropriate antibiotics
Lysis BufferTris-based buffer (pH 8.0) with mild detergents

It's important to note that membrane proteins like cemA often form inclusion bodies when overexpressed. Therefore, optimization strategies including fusion partners (e.g., MBP, SUMO) or specialized solubilization buffers containing non-ionic detergents may be necessary to obtain functional protein .

What purification protocols yield highest purity and activity for recombinant cemA?

A multi-step purification protocol is recommended for obtaining high-purity recombinant cemA:

  • Affinity Chromatography:

    • For His-tagged cemA: Ni-NTA resin with imidazole gradient elution

    • Buffer composition: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 5-250 mM imidazole

  • Size Exclusion Chromatography:

    • Column: Superdex 200 or similar

    • Buffer: 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol

  • Storage Conditions:

    • Aliquot and store at -80°C with 50% glycerol

    • Avoid repeated freeze-thaw cycles

Protein purity should be verified by SDS-PAGE (>90% purity) and western blotting using anti-His antibodies or custom cemA antibodies. Activity assays must be designed based on the specific function being investigated.

How can I generate antibodies specific to cemA for immunolocalization studies?

For generating specific antibodies against cassava cemA:

  • Antigen Selection:

    • Choose unique epitopes (10-15 amino acids) from hydrophilic regions of cemA

    • Avoid transmembrane domains which may be poorly immunogenic

    • Multiple antigenic peptides can be synthesized to increase chances of success

  • Immunization Protocol:

    • Use purified recombinant cemA or synthetic peptide conjugated to KLH

    • Rabbits are recommended for polyclonal antibodies

    • Standard 12-week immunization schedule with 4-5 boosts

  • Antibody Validation:

    • Western blot against recombinant protein and native protein extracts

    • Immunoprecipitation followed by mass spectrometry

    • Pre-absorption controls to confirm specificity

  • Immunolocalization Methodology:

    • Tissue fixation: 4% paraformaldehyde in PBS

    • Antigen retrieval: Microwave treatment in citrate buffer

    • Detection: Fluorescent secondary antibodies or enzymatic detection systems

When using these antibodies for localization studies, both positive controls (known chloroplast envelope proteins) and negative controls (pre-immune serum) should be included.

How does cemA contribute to cassava's stress response mechanisms?

While direct evidence for cemA's role in stress response is limited, proteomics studies of cassava under various stresses provide a framework for investigation :

  • Experimental Design:

    • Expose cassava plants to abiotic stresses (drought, heat, salinity)

    • Harvest leaf tissue at defined time points (0, 6, 12, 24, 48 hours)

    • Extract total protein using optimized protocols for membrane proteins

    • Perform quantitative proteomics (iTRAQ or TMT labeling)

  • Research Findings:

    • Chloroplast membrane proteins, including those potentially interacting with cemA, show differential expression under stress conditions

    • Post-translational modifications of chloroplast proteins increase during stress response

    • Reactive oxygen species (ROS) management systems in chloroplasts are upregulated

  • Methodological Approaches:

    • Targeted proteomics focusing on chloroplast envelope proteins

    • Co-immunoprecipitation using cemA antibodies followed by mass spectrometry

    • Comparative transcriptomics and proteomics to identify stress-responsive networks

Understanding cemA's role in stress responses could inform breeding strategies for developing more resilient cassava varieties, particularly important given cassava's role in food security in marginal environments .

What is the evolutionary significance of cemA in Euphorbiaceae and related families?

Evolutionary analysis of cemA across plant species reveals important insights:

  • Sequence Conservation Analysis:

    • cemA shows moderate sequence conservation across Euphorbiaceae

    • Higher conservation in transmembrane domains than in loop regions

    • Key functional residues maintain strict conservation

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios across different plant lineages

    • Evidence suggests purifying selection dominates cemA evolution

    • Compare selection patterns with other chloroplast genes

  • Structural Evolution:

    • Predict structural models across diverse species

    • Analyze conservation of protein folding patterns despite sequence divergence

    • Identify lineage-specific structural adaptations

  • Research Methods:

    • Multiple sequence alignment using MUSCLE or MAFFT

    • Phylogenetic analysis using maximum likelihood methods

    • Selection analysis using PAML or HyPhy software packages

    • Structural prediction using AlphaFold or similar tools

The evolutionary conservation of cemA highlights its essential function in chloroplast biology across diverse plant lineages, including the economically important Euphorbiaceae family .

How does cemA interact with the cassava chloroplast proteome network?

Understanding protein-protein interactions involving cemA requires sophisticated methodologies:

  • Experimental Approaches:

    • Split-ubiquitin yeast two-hybrid system (optimized for membrane proteins)

    • Co-immunoprecipitation using cemA-specific antibodies

    • Proximity labeling techniques (BioID or APEX2)

    • Cross-linking mass spectrometry (XL-MS)

  • Chloroplast Interactome Mapping:

    • Constructs expressing cemA fused to affinity tags

    • Transfection into protoplasts from cassava leaves

    • Pull-down experiments followed by mass spectrometry

    • Network analysis of interaction partners

  • Functional Validation:

    • CRISPR/Cas9-mediated mutagenesis of cemA

    • Bimolecular fluorescence complementation (BiFC) to confirm interactions

    • Chloroplast isolation and fractionation to localize interaction complexes

Preliminary data suggests cemA may interact with components of photosynthetic complexes and other envelope membrane proteins involved in metabolite transport, though specific interaction partners in cassava await comprehensive characterization .

What role might cemA play in cassava genetic improvement strategies?

Given cassava's importance for food security, the potential applications of cemA in breeding programs include:

  • Chloroplast Engineering Approaches:

    • cemA as a neutral integration site for transgenes

    • Promoter engineering to enhance expression of beneficial traits

    • Targeted modification using CRISPR-based technologies

  • Photosynthetic Efficiency Enhancement:

    • Screen for natural variants of cemA in diverse cassava germplasm

    • Analyze association with photosynthetic efficiency traits

    • Introduce beneficial alleles through conventional breeding or genetic engineering

  • Methodological Framework:

    • High-throughput genotyping using genotyping-by-sequencing (GBS)

    • Genome-wide association studies (GWAS) to identify beneficial cemA variants

    • Transgenic approaches for functional validation

    • Field trials under diverse environmental conditions

  • Research Considerations:

    • Balance between improving yield and maintaining stress tolerance

    • Integration with breeding programs focused on root quality traits

    • Regulatory pathways for chloroplast-engineered crops

Genetic diversity studies have shown high genome-wide diversity in traditional Brazilian cassava varieties, providing valuable genetic resources for improvement programs . Leveraging this diversity through targeted approaches focusing on chloroplast genes like cemA could contribute to developing improved varieties with enhanced photosynthetic efficiency and stress tolerance.

How can I overcome expression challenges for cemA as a membrane protein?

Membrane proteins like cemA present specific challenges for recombinant expression:

  • Common Problems and Solutions:

ChallengeSolution Approach
Inclusion body formationLower induction temperature (16°C); use specialized E. coli strains (C41/C43)
Low expression levelsCodon optimization; use strong inducible promoters (T7, tac)
Protein misfoldingCo-express with molecular chaperones (GroEL/GroES)
Toxicity to host cellsUse tight expression control; leaky expression control vectors
Protein aggregationInclude mild detergents (DDM, LDAO) in lysis buffer
  • Alternative Expression Systems:

    • Cell-free protein synthesis systems optimized for membrane proteins

    • Pichia pastoris for eukaryotic expression environment

    • Insect cell expression systems using baculovirus vectors

  • Fusion Strategies:

    • N-terminal fusions with highly soluble partners (MBP, SUMO, Trx)

    • Inclusion of purification tags (His, Strep, FLAG)

    • Cleavable linkers for tag removal post-purification

These approaches can significantly improve the yield and quality of recombinant cemA protein for structural and functional studies.

What are the best methods for analyzing cemA in proteomic studies of cassava?

Optimized protocols for cemA detection in proteomic studies include:

  • Sample Preparation:

    • Enrichment of chloroplast fractions from cassava leaf tissue

    • Specialized extraction buffers containing:

      • 0.5% SDS for initial solubilization

      • Acetone precipitation for protein concentration

      • Resuspension in buffers compatible with downstream applications

  • Membrane Protein Analysis:

    • gel-based approaches: BN-PAGE for intact membrane complexes

    • gel-free approaches: specialized digestion protocols using multiple proteases

    • Peptide fractionation using high-pH reverse phase prior to LC-MS/MS

  • Mass Spectrometry Parameters:

    • Extended gradient separations (90-120 min)

    • HCD fragmentation optimized for hydrophobic peptides

    • Data-dependent acquisition with inclusion lists for cemA peptides

    • Parallel reaction monitoring (PRM) for targeted quantification

  • Data Analysis:

    • Database searches against the Manihot esculenta genome

    • Consider post-translational modifications common in chloroplast proteins

    • Normalization using multiple reference proteins

    • Statistical analysis comparing different experimental conditions

These approaches maximize the detection and quantification of cemA and other chloroplast membrane proteins in complex cassava samples.

How can I validate predicted cemA functions through genetic manipulation in cassava?

Functional validation strategies include:

  • CRISPR/Cas9 Gene Editing:

    • Design guide RNAs targeting cemA in the chloroplast genome

    • Delivery methods:

      • Biolistic transformation of cassava embryogenic callus

      • Agrobacterium-mediated transformation

    • Screening strategies:

      • PCR-based genotyping

      • Chloroplast genome sequencing

      • Phenotypic analysis

  • RNA Interference Approaches:

    • Design of cemA-specific hairpin constructs

    • Stable transformation into cassava

    • Analysis of knockdown efficiency by qRT-PCR

    • Phenotypic characterization focusing on photosynthesis parameters

  • Complementation Studies:

    • Transformation with cemA variants from diverse species

    • Expression of site-directed mutants

    • Phenotypic rescue assessment

  • Phenotypic Analysis Methods:

    • Chlorophyll fluorescence measurements (Fv/Fm, ETR)

    • Gas exchange parameters (CO2 assimilation, transpiration)

    • Metabolomic profiling of photosynthetic intermediates

    • Ultrastructural analysis of chloroplasts by electron microscopy

These approaches can provide direct evidence for cemA function through careful experimental design and comprehensive phenotypic analysis .

How should I interpret contradictory results between transcriptomic and proteomic analyses of cemA?

When facing discrepancies between transcriptomic and proteomic data:

  • Methodological Considerations:

    • RNA extraction protocols may have different efficiencies for chloroplast transcripts

    • Membrane protein extraction is often challenging, potentially leading to cemA underrepresentation

    • Different normalization methods can affect quantitative comparisons

    • Time delays between transcription and translation require temporal analysis

  • Biological Explanations:

    • Post-transcriptional regulation of chloroplast gene expression

    • Differential protein stability and turnover rates

    • Retrograde signaling between nucleus and chloroplasts

  • Analytical Approach:

    • Perform time-course experiments capturing both transcripts and proteins

    • Analyze correlation patterns across multiple conditions

    • Consider post-translational modifications that affect protein function

    • Validate key findings using orthogonal methods (e.g., western blots, targeted proteomics)

  • Integration Framework:

    • Pathway-based analysis incorporating both data types

    • Machine learning approaches to identify patterns across multi-omics datasets

    • Network analysis to place cemA in context of broader cellular processes

These strategies help resolve apparent contradictions and provide a more comprehensive understanding of cemA regulation and function.

What statistical approaches are most appropriate for cemA expression analysis across diverse cassava varieties?

For comparing cemA expression across cassava germplasm:

  • Experimental Design Considerations:

    • Balanced sampling across genetic groups

    • Control for environmental and developmental factors

    • Appropriate technical and biological replication

  • Statistical Methods:

    • Linear mixed models accounting for genetic background

    • ANOVA with post-hoc tests for multiple comparisons

    • Non-parametric alternatives for non-normal distributions

    • Association analysis with genetic markers for eQTL identification

  • Example Analysis Workflow:

    • Normalize expression data (FPKM, TPM, or similar metrics)

    • Transform data if necessary (log2 transformation common)

    • Apply appropriate statistical tests based on experimental design

    • Correct for multiple testing (FDR, Bonferroni)

    • Visualize results using heat maps, principal component analysis, or similar approaches

  • Interpretation Guidelines:

    • Consider both statistical significance and effect size

    • Correlate expression patterns with physiological traits

    • Integrate with genetic diversity data for evolutionary insights

These approaches enable robust comparison of cemA expression patterns across diverse cassava germplasm, potentially identifying varieties with beneficial expression profiles.

How can I integrate cemA research findings with broader cassava improvement goals?

Translating cemA research into cassava improvement requires:

  • Integration Framework:

    • Connect molecular findings to agronomically relevant traits

    • Identify potential trade-offs between enhanced cemA function and other traits

    • Develop screening protocols applicable to breeding populations

    • Establish collaborative networks between molecular biologists and breeders

  • Translation Strategies:

    • Marker development for beneficial cemA variants

    • Transgenic approaches for proof-of-concept validation

    • TILLING or eco-TILLING to identify natural variants

    • Integration with genome-wide selection approaches

  • Impact Assessment:

    • Field trials under diverse environmental conditions

    • Evaluation of yield stability across environments

    • Nutritional analysis of storage roots

    • Farmer participatory assessment of improved varieties

  • Case Studies:

    • Potential contribution to enhancing photosynthetic efficiency

    • Role in stress tolerance improvement

    • Connection to post-harvest traits through primary metabolism effects

This integrated approach ensures that fundamental research on cemA contributes meaningfully to addressing challenges in cassava production and utilization, ultimately benefiting farmers and consumers in regions where cassava is a staple food.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.