Recombinant Manihot esculenta NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Function

The primary function of the NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic is to participate in electron transport within the chloroplast . The NDH complex, of which NdhC is a subunit, plays a crucial role in:

  • Electron Transfer: Shuttling electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur centers .

  • Redox Reactions: Coupling redox reactions to proton translocation, conserving redox energy in a proton gradient .

  • Photosynthesis: Facilitating photosynthetic processes by maintaining the appropriate redox balance in the chloroplast .

Structure and Characteristics

NdhC is a subunit of the larger NDH complex, and exhibits the following characteristics:

CharacteristicDescription
Gene NamendhC
Protein NameNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
OrganismManihot esculenta (cassava)
Molecular WeightApparent molecular weight is 45-49 kDa
ExpressionExpressed in E. coli
Amino Acid Length1-120aa
ModificationsMay be fused to an N-terminal His tag for purification and identification
UniProt Accession NumberB1NWF5

Recombinant Production

Recombinant NdhC is produced using genetic engineering techniques where the gene encoding NdhC from Manihot esculenta is inserted into a host organism like E. coli to produce the protein in large quantities . The recombinant protein is often expressed with a Histidine (His) tag, which allows for easy purification using affinity chromatography .

Biological Significance

The NDH complex, including the NdhC subunit, is vital for the efficient operation of photosynthesis and the plant's response to environmental stresses.

  • Stress Response: Helps plants adapt to fluctuating environmental conditions by regulating the electron flow in the photosynthetic electron transport chain .

  • Metabolic Regulation: Contributes to the balance of ATP and NADPH production in the chloroplast, which is essential for various metabolic processes .

Quinones

Quinones, which interact with the NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, are a class of organic compounds with diverse biological activities. Quinones and their analogs have been studied for various applications:

  • Antimicrobial and Antitumoral Activities: Some quinones exhibit antimicrobial and antitumoral properties, making them relevant in pharmacological research .

  • Proteasome Inhibition: Certain naphthoquinones have been identified as proteasome inhibitors, showing selectivity for cancer cells over normal cells .

  • Inhibitory Activity: The chloronaphthoquinone moiety is critical for inhibitory activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Manihot esculenta (Cassava) (Jatropha manihot)
Target Names
ndhC
Target Protein Sequence
MFLIYEYDIFWAFLIISSVIPILAFLISGVLSPISKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGLSVFIEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does NAD(P)H-quinone oxidoreductase contribute to photosynthesis in cassava?

NAD(P)H-quinone oxidoreductase contributes to photosynthesis in cassava by functioning as a key component of the chloroplast NDH complex in the thylakoid membrane. This complex plays several critical roles:

  • Cyclic electron flow: It facilitates cyclic electron transport around Photosystem I, generating ATP without producing NADPH, which helps balance the ATP/NADPH ratio required for carbon fixation .

  • Proton gradient formation: The enzyme couples electron transport with proton translocation across the thylakoid membrane, contributing to the proton motive force used for ATP synthesis .

  • Stress protection: In tropical environments where cassava grows, the NDH complex helps protect the photosynthetic apparatus from damage under high light intensity and during drought periods.

  • Carbon metabolism: By influencing energy availability, this enzyme indirectly affects carbon allocation between starch, carotenoid biosynthesis, and other metabolic pathways in cassava .

These functions make NAD(P)H-quinone oxidoreductase subunit 3 particularly important for cassava's adaptation to its typical growing conditions and for optimizing photosynthetic efficiency.

What expression systems are suitable for producing recombinant Manihot esculenta NAD(P)H-quinone oxidoreductase subunit 3?

Multiple expression systems have been successfully employed for the recombinant production of this protein:

Expression SystemAdvantagesConsiderations
E. coliMost commonly used; high yield; cost-effectiveMay require codon optimization for plant genes
YeastBetter post-translational modifications; good for membrane proteinsLonger production time; more complex media
BaculovirusExcellent for complex proteins; more plant-like modificationsTechnically demanding; higher cost
Mammalian cellsMost sophisticated post-translational modificationsHighest cost; lowest yield

Commercial preparations of this protein typically achieve >90% purity . When selecting an expression system, researchers should consider the intended experimental use, required yield, and whether post-translational modifications are critical for their specific application.

What purification strategies are most effective for isolating this protein?

Based on successful approaches with related oxidoreductases, the following purification strategy is recommended:

  • Affinity chromatography: Using polyhistidine tags is highly effective. Researchers have successfully purified related oxidoreductase heterodimers using "stepwise elution with imidazole from a nickel nitrilotriacetate column under nondenaturing conditions" .

  • Tag selection: While polyhistidine tags are most common, the tag type can be optimized during the production process to suit specific experimental needs .

  • Buffer optimization: The protein should be maintained in a Tris-based buffer containing 50% glycerol to preserve stability and activity .

  • Storage conditions: Store at -20°C for routine use, or at -80°C for extended storage. Working aliquots can be kept at 4°C for up to one week, but repeated freezing and thawing should be avoided .

This approach has been shown to maintain the native conformation and enzymatic activity of related oxidoreductases, making it suitable for the cassava enzyme.

What spectroscopic techniques are most effective for studying the redox properties of this enzyme?

Several complementary spectroscopic techniques are recommended for comprehensive analysis of the redox properties of NAD(P)H-quinone oxidoreductase:

  • Stopped-flow spectrophotometry: This technique allows real-time monitoring of transient reaction kinetics and has been successfully employed to study electron transfer processes in related oxidoreductases. It's particularly valuable for determining reaction rates and intermediates .

  • Electron spin resonance (ESR) spectroscopy: ESR has been effective for detecting free radicals produced during oxidoreductase activity and can provide insights into the enzyme's mechanism .

  • High-resolution mass spectrometry: This approach enables identification of reaction products and has been used to characterize the specific chemical changes resulting from oxidoreductase activity .

  • UV-Visible absorption spectroscopy: Essential for monitoring changes in the oxidation state of flavin cofactors (like FMN) typically associated with NAD(P)H-quinone oxidoreductases.

When combined, these techniques provide comprehensive characterization of electron transfer kinetics, redox potential, and reaction mechanisms of the enzyme.

How can researchers assess the impact of mutations on enzyme activity?

To assess the impact of mutations on NAD(P)H-quinone oxidoreductase activity, researchers should:

  • Identify candidate residues: Based on related oxidoreductases, cysteine residues are often critical for modulating the balance between oxidase and monooxygenase activities. In one study of L-amino acid oxidase/monooxygenase, "saturation mutagenesis studies were carried out on 5 cysteine residues, and researchers identified an L-AAO/MOG C254I mutant enzyme, which showed 5 times higher specific oxidase activity than that of the wild type" .

  • Design mutagenesis strategy: Random saturation mutagenesis at specific residues, followed by screening based on oxidase activity, has proven effective . For the cassava enzyme, this approach could target:

    • Conserved cysteine residues

    • Residues near the putative active site

    • Residues involved in cofactor binding

  • Activity assays: Compare the following properties between wild-type and mutant enzymes:

    • Km and kcat values for NAD(P)H

    • Substrate specificity

    • Product formation rates

    • Oxidase vs. electron transfer functions

  • Structural analysis: Crystal structure determination, as was done with L-AAO/MOG, is essential to identify key residues for targeted mutagenesis and to understand the structural basis of altered activity .

This systematic approach can reveal crucial residues for enzyme function and potentially lead to variants with enhanced properties for specific applications.

How can heterodimer approaches advance understanding of subunit interactions?

Heterodimer approaches can provide unique insights into the functional relationships between subunits in NAD(P)H-quinone oxidoreductase. A study by Cui et al. on related NAD(P)H:quinone oxidoreductase demonstrated this approach by creating and analyzing wild-type/mutant heterodimers .

Methodology overview:

  • Express a heterodimer with one wild-type subunit (tagged with polyhistidine) and one mutant subunit

  • Purify the heterodimer from homodimers using nickel affinity chromatography

  • Confirm heterodimer composition using SDS and native PAGE with immunoblot analysis

  • Compare enzyme kinetics with different electron acceptors

Key findings from related enzymes:

  • With two-electron acceptors (e.g., 2,6-dichloroindophenol, menadione), subunits function independently: Km values of heterodimers were similar to wild-type homodimers, but kcat values were approximately 50% of wild-type

  • With four-electron acceptors (e.g., methyl red), subunits function cooperatively: heterodimer kinetic properties resembled those of the less efficient mutant homodimer

This approach could be applied to the cassava enzyme to determine how subunit composition affects function in the chloroplast electron transport chain, where complex electron transfer processes occur.

How does NAD(P)H-quinone oxidoreductase activity relate to carbon metabolism in cassava?

NAD(P)H-quinone oxidoreductase plays a significant albeit indirect role in carbon metabolism pathways in cassava, particularly affecting the balance between starch and carotenoid biosynthesis:

  • Energy production: As part of the photosynthetic electron transport chain, this enzyme contributes to ATP generation that fuels various biosynthetic pathways .

  • Carbon allocation: Research has identified "a notable negative correlation between provitamin A and starch accumulation" in cassava, attributed to "competition among various carbon pathways" . The function of electron transport components influences the energy available for different metabolic pathways.

  • Metabolic shift in yellow-fleshed varieties: Studies show that "yellow-fleshed cultivars, in comparison to their white-fleshed counterparts, direct more carbon toward the synthesis of raffinose and cell wall components" instead of starch . This shift may be partially influenced by differences in electron transport efficiency.

  • ATP/NADPH balance: The balance between linear and cyclic electron flow (involving NAD(P)H-quinone oxidoreductase) affects the ATP/NADPH ratio available for carbon fixation and subsequent partitioning into different metabolic pathways .

Understanding the role of this enzyme could potentially help in developing strategies to optimize both nutritional value (carotenoids) and yield (starch) in cassava breeding programs.

What role does NAD(P)H-quinone oxidoreductase play in stress responses in cassava?

While specific data on NAD(P)H-quinone oxidoreductase in cassava stress responses is limited, its function as part of the NDH complex suggests several important roles:

  • Photoprotection: The NDH-mediated cyclic electron flow helps dissipate excess excitation energy under high light conditions, preventing photodamage to the photosynthetic apparatus. This is particularly relevant for cassava growing in tropical environments with high solar radiation .

  • Drought adaptation: During water stress, cyclic electron transport becomes more important for maintaining photosynthetic function while minimizing water loss. The NAD(P)H-quinone oxidoreductase complex contributes to this adaptation mechanism .

  • Oxidative stress management: Related NAD(P)H oxidoreductases have been shown to play important roles in managing reactive oxygen species. For example, in other systems, "NADPH oxidase-derived free radicals are key oxidants" in stress responses .

  • Energy conservation: Under stress conditions that limit carbon fixation, the efficient recycling of electrons through cyclic pathways involving NAD(P)H-quinone oxidoreductase helps maintain energy balance in the chloroplast.

Targeting the expression or activity of this enzyme could potentially be a strategy for enhancing stress tolerance in cassava, which is often grown in marginal environments subject to drought, heat, and high light stress.

How does the expression of NAD(P)H-quinone oxidoreductase vary between different cassava genotypes?

Research on expression patterns of photosynthetic genes in cassava indicates significant variation between genotypes with different characteristics:

  • Domesticated vs. wild genotypes: Studies comparing domesticated cassava (Arg7) with its wild ancestor (W14, M. esculenta ssp. flabellifolia) found that "Arg7 has a higher net photosynthesis rate in leaves, higher ribulose-1,5-bisphosphate carboxylase oxygenase activities in leaves" . This suggests potential differences in expression of photosynthetic electron transport components, including NAD(P)H-quinone oxidoreductase.

  • Differential gene expression: Research using full-length cDNA libraries identified "24 differentially expressed genes involved in starch metabolism and photosynthesis" between cassava genotypes , indicating that photosynthetic genes show expression variation between different varieties.

  • Yellow vs. white-fleshed varieties: Studies of cassava genotypes with varying levels of carotenoids found that genes associated with photosynthesis and carbon metabolism are differentially expressed between yellow- and white-fleshed storage roots . This may include differences in expression of electron transport components like NAD(P)H-quinone oxidoreductase.

  • Genetic diversity: Genome-wide association studies of cassava have identified significant genetic diversity in genes related to cellular processes, including those involved in electron transport and energy metabolism .

These differences in expression patterns may contribute to the observed variation in photosynthetic efficiency, stress tolerance, and carbon partitioning between starch and other metabolites across cassava genotypes.

How can understanding NAD(P)H-quinone oxidoreductase function contribute to cassava improvement programs?

Knowledge about NAD(P)H-quinone oxidoreductase function can contribute to cassava improvement in several ways:

By integrating knowledge of this enzyme's function with broader cassava improvement goals, researchers can develop more targeted approaches to creating varieties with improved yield, nutrition, and resilience.

What are the most promising research directions for future studies of this protein?

Several promising research directions emerge from current knowledge about NAD(P)H-quinone oxidoreductase in cassava:

  • Structure-function relationships: Determining the crystal structure of the cassava enzyme would enable more targeted approaches to understanding its function and potentially engineering improved variants. As demonstrated with related enzymes, "crystal structure determination... [revealed] the key residue for the activity conversion" .

  • Subunit interactions: Applying heterodimer approaches like those used with related enzymes could provide insights into "the functional and structural relationships of subunits" in the cassava NDH complex.

  • Genetic diversity exploration: Systematic analysis of genetic variation in ndh genes across cassava germplasm could identify naturally occurring alleles with beneficial properties for breeding. Genome-wide association studies have already revealed significant genetic diversity in cassava .

  • Metabolic engineering: Investigating how modifications to NAD(P)H-quinone oxidoreductase expression affect carbon partitioning between starch, carotenoids, and other metabolites could lead to novel approaches for engineering improved nutritional quality without sacrificing yield.

  • Stress adaptation mechanisms: Deeper investigation of how this enzyme contributes to stress responses in cassava could reveal new targets for enhancing resilience to drought, heat, and high light conditions.

  • Integration with systems biology: Combining studies of NAD(P)H-quinone oxidoreductase with broader transcriptomic, proteomic, and metabolomic analyses could provide a more comprehensive understanding of its role in cassava physiology and development.

These research directions could significantly advance understanding of cassava biochemistry and provide new tools for crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.