Recombinant Manihot esculenta NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

What is the structure and basic function of NAD(P)H-quinone oxidoreductase subunit 6 in Manihot esculenta?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a chloroplast-encoded protein that forms part of the NAD(P)H dehydrogenase complex. This membrane-bound protein participates in cyclic electron flow around photosystem I, contributing to chlororespiration and photoprotection. The mature protein consists of 176 amino acids with the sequence: MDLPGLIHDFLLVFLGLGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFNLWTVGSGVTSLVCTSIFVSLITIIPDTSWYGIIWTTKTNQIIEQDLISNGQQIGIHLSTDFFLPFEFISIILLVALIGAIAVARQ . The protein has a UniProt identification number of B1NWK2 and is also known as NADH-plastoquinone oxidoreductase subunit 6 . Its hydrophobic amino acid sequence suggests multiple transmembrane domains, contributing to its integration in the thylakoid membrane.

How does RNA editing affect the function of ndhG in plant species?

RNA editing of ndhG, particularly at position C50, causes critical amino acid substitutions that can significantly alter protein function. In Brassicaceae, editing of ndhG C50 creates an F or L codon from an S codon, representing a radical amino acid change from a polar (serine) to a nonpolar (phenylalanine or leucine) residue . This substitution likely affects protein folding, stability, and functionality within the NAD(P)H dehydrogenase complex. Studies across multiple plant species show variable editing efficiency at this position, ranging from nearly complete editing to its complete absence. For instance, in Lepidium maritima, the C50 position shows less than 10% conversion to T in green leaf tissue, suggesting reduced editing activity . Such variation in editing efficiency may correlate with differential adaptation to environmental stresses or metabolic requirements among species.

What methods are recommended for initial characterization of recombinant ndhG protein activity?

Initial characterization should incorporate multiple complementary approaches:

• Spectrophotometric Assays: Monitor NAD(P)H oxidation at 340 nm using various quinone substrates (e.g., 1,2-naphthoquinone, 9,10-phenanthrenequinone) to establish substrate preference and kinetic parameters .

• Electron Transfer Analysis: Assess single-electron transfer capacity using electron acceptors such as cytochrome c or ferricyanide to determine the mechanism of electron flow .

• Membrane Integration Studies: Utilize liposome reconstitution combined with fluorescence quenching to verify proper membrane insertion and orientation.

• Binding Assays: Employ isothermal titration calorimetry or surface plasmon resonance to quantify NAD(P)H binding affinity and thermodynamics.

• pH and Temperature Profiling: Determine optimal conditions by assessing activity across pH range 5.0-9.0 and temperatures between 4-55°C.

Results should be analyzed using appropriate enzyme kinetics models, with particular attention to potential substrate inhibition effects often observed with quinone substrates.

What are the optimal storage conditions for maintaining recombinant ndhG protein stability?

Repeated freeze-thaw cycles significantly compromise protein stability and should be strictly avoided . To prevent this, it is advisable to prepare multiple small-volume aliquots during initial processing. If activity assessment is required after extended storage, a comparative analysis with a fresh preparation or reference standard should be performed to quantify any potential activity loss. Additionally, the inclusion of reducing agents such as DTT (1-5 mM) in the storage buffer may help maintain thiol groups in their reduced state, potentially enhancing stability for this membrane-associated protein.

How should researchers optimize protein expression systems for ndhG given its membrane-associated nature?

Optimizing expression systems for membrane-associated proteins like ndhG requires addressing several critical challenges:

• Expression System Selection:

  • Prokaryotic systems (E. coli): Use C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Eukaryotic systems: Consider insect cell lines (Sf9, High Five™) for better membrane protein folding

• Vector Design Considerations:

  • Incorporate fusion tags that enhance solubility (SUMO, MBP) rather than just affinity tags

  • Include cleavable signal sequences directing the protein to membranes

  • Consider codon optimization for the expression host

• Expression Parameters:

  • Lower induction temperature (16-20°C) to slow folding and reduce inclusion body formation

  • Reduce inducer concentration to decrease expression rate

  • Extend expression time (48-72 hours) for improved folding

• Extraction Optimization:

  • Evaluate detergent screening panel (DDM, LDAO, Brij-35) for optimal solubilization

  • Consider native lipid co-extraction to maintain structural integrity

  • Implement two-phase extraction for membrane proteins

Statistical design of experiments (DoE) should be employed to systematically analyze the influence of multiple variables on expression yield and activity. Response surface methodology with central composite design has proven effective for optimizing similar enzyme production protocols .

What analytical techniques are most appropriate for assessing the purity and integrity of recombinant ndhG preparations?

Multiple complementary analytical techniques should be employed to comprehensively assess ndhG preparations:

Table 1: Analytical Techniques for ndhG Quality Assessment

For membrane proteins like ndhG, detergent extraction efficiency and protein-detergent complex stability should be carefully monitored using techniques such as fluorescence-detection size exclusion chromatography (FSEC). Additionally, negative-stain electron microscopy can provide valuable information about sample homogeneity and structural integrity at the single-particle level.

How does the function of ndhG in Manihot esculenta compare to homologs in other plant species?

NAD(P)H-quinone oxidoreductase subunit 6 exhibits both conserved and species-specific functional characteristics across plant species. The core electron transport function is preserved, but several key differences exist:

Manihot esculenta ndhG appears to have undergone evolutionary changes similar to other Euphorbiaceae family members. Comparative analysis with Ricinus communis (castor bean) shows that both species have experienced genomic changes at the ndhG C50 position, substituting it with a genomic T rather than maintaining RNA editing at this site . This suggests a different evolutionary trajectory for Euphorbiaceae compared to Brassicaceae species.

The pairwise dN/dS value between M. esculenta and R. communis for genes associated with ndhG regulation (such as CRR21) is 0.276, indicating strong negative selection even when the genes are truncated . This evolutionary pressure suggests that despite changes in editing patterns, the fundamental function of the protein remains essential. Unlike some Brassicaceae species that show variable RNA editing efficiency at ndhG C50, M. esculenta appears to have resolved this by direct genomic substitution, potentially providing more consistent protein function across different environmental conditions.

These differences likely reflect adaptations to specific environmental niches, with M. esculenta potentially requiring more robust cyclic electron transport to support its growth in tropical and subtropical regions where light intensities and temperatures may create greater oxidative stress for the photosynthetic apparatus.

What experimental approaches are recommended for studying protein-protein interactions involving ndhG in the chloroplast membrane?

Investigating protein-protein interactions for membrane-embedded ndhG requires specialized approaches:

• Chemical Cross-linking coupled with Mass Spectrometry (XL-MS):

  • Utilize membrane-permeable cross-linkers (DSS, BS3) to capture transient interactions

  • Follow with digestion, enrichment, and high-resolution MS/MS analysis

  • Analyze data using specialized software (e.g., xQuest, Kojak) to identify cross-linked peptides

• Co-immunoprecipitation with membrane solubilization:

  • Optimize gentle detergent conditions (digitonin, DDM at critical micelle concentration)

  • Use antibodies against ndhG or epitope-tagged versions

  • Confirm interactions with western blotting and mass spectrometry

• Split-fluorescent protein complementation:

  • Generate constructs with ndhG fused to one half of a fluorescent protein (e.g., YFP)

  • Create a library of potential interactors fused to the complementary half

  • Analyze reconstituted fluorescence in chloroplasts using confocal microscopy

• Förster Resonance Energy Transfer (FRET):

  • Label ndhG and potential partners with appropriate donor-acceptor fluorophore pairs

  • Measure energy transfer using fluorescence lifetime imaging microscopy (FLIM)

  • Calculate interaction distances based on FRET efficiency

• Cryo-electron microscopy:

  • Purify intact complexes containing ndhG using gentle solubilization

  • Perform single-particle analysis to determine structural arrangements

  • Map protein positions within larger assemblies

For functional validation of identified interactions, implement CRISPR-based knockout or modification systems in model plants, followed by biochemical and physiological analysis of photosynthetic parameters.

What techniques are most effective for studying the role of ndhG in cyclic electron flow and photoprotection?

A multi-level experimental approach is essential for fully characterizing ndhG's role in cyclic electron flow and photoprotection:

• Chlorophyll Fluorescence Analysis:

  • Measure PSII and PSI parameters using PAM fluorometry

  • Determine energy-dependent quenching (qE) and state transitions (qT)

  • Assess cyclic electron flow using post-illumination fluorescence rise

• P700 Absorbance Measurements:

  • Monitor P700 oxidation-reduction kinetics under varying light conditions

  • Quantify PSI acceptor-side limitation

  • Determine cyclic electron flow rates by comparing linear and cyclic flows

• Electrochromic Shift (ECS) Spectroscopy:

  • Measure proton motive force (PMF) generation

  • Distinguish between linear and cyclic contribution to thylakoid energization

  • Assess kinetics of PMF formation and dissipation

• Reactive Oxygen Species (ROS) Monitoring:

  • Utilize specific fluorescent probes for different ROS types

  • Quantify oxidative damage markers (lipid peroxidation, protein carbonylation)

  • Compare wild-type and ndhG-modified plants under photostress conditions

• Isotope Labeling and Metabolic Flux Analysis:

  • Trace electron flow pathways using isotope-labeled substrates

  • Determine ATP/NADPH production ratios under varying conditions

  • Map metabolic adjustments during environmental stress

These techniques should be applied comparatively between wild-type plants and those with altered ndhG function, ideally under controlled environmental conditions that challenge photosynthetic efficiency (high light, temperature fluctuations, drought).

How do researchers effectively analyze RNA editing patterns for ndhG across different plant species?

RNA editing analysis for ndhG requires a systematic approach combining molecular techniques and computational analysis:

• Sample Preparation and RNA Extraction:

  • Collect tissues at consistent developmental stages

  • Extract total RNA using methods that preserve RNA integrity

  • Perform DNase treatment to eliminate genomic DNA contamination

• Primary Analysis Techniques:

  • RT-PCR followed by Sanger sequencing of cDNA

  • High-throughput sequencing of amplicons spanning editing sites

  • Direct RNA sequencing to avoid reverse transcription artifacts

• Quantitative Assessment:

  • Poisoned primer extension assays for site-specific editing efficiency

  • Pyrosequencing for precise editing percentage determination

  • Digital droplet PCR for absolute quantification of edited/unedited transcripts

• Bioinformatic Analysis Pipeline:

  • Alignment of RNA-seq reads to reference genomes

  • Implementation of specialized tools (REDItools, PREP-Mt)

  • Statistical assessment of editing efficiency using mixed models

• Validation Strategies:

  • Amplicon sequencing from multiple biological replicates

  • Independent technical approaches to confirm editing rates

  • Controlled comparison across developmental stages and tissues

For comparative studies, it's essential to analyze multiple plant species under standardized conditions. The ndhG C50 editing site is particularly informative, as editing efficiencies can vary dramatically between species, ranging from 10% to 80% conversion rates . When examining evolutionary patterns, researchers should correlate editing efficiency with both phylogenetic relationships and ecological adaptations.

What insights have been gained about the evolution of ndhG editing sites in different plant lineages?

Research has revealed complex evolutionary dynamics affecting ndhG editing:

Three distinct evolutionary strategies have been observed regarding ndhG C50:

• Maintenance of RNA editing: Many species retain a genomic C at position 50 and edit it post-transcriptionally with varying efficiency.

• Genomic T substitution: Multiple independent lineages have replaced the genomic C with a T, eliminating the need for editing while preserving the functional amino acid. This pattern is observed in Draba nemorosa and in Euphorbiaceae species including Manihot esculenta and Ricinus communis .

• Loss of editing capacity: Some species like Lobularia maritima and Arabis hirsuta retain the genomic C but show minimal editing (<10%), suggesting loss of the editing machinery while maintaining the genomic sequence .

Particularly noteworthy is that these changes have occurred independently at different nodes in the phylogenetic tree, indicating convergent evolution. The pairwise dN/dS value of 0.276 between M. esculenta and R. communis for editing-related genes suggests strong negative selection even after editing site loss , highlighting the continued importance of these genetic elements despite functional shifts.

How do cis-elements and trans-factors influence ndhG editing efficiency, and how can these be experimentally characterized?

The interplay between cis-elements and trans-factors critically determines ndhG editing efficiency:

Cis-elements characteristics:
The recognition sequences for ndhG C50 editing typically span approximately 25 nucleotides, from positions -20 to +5 relative to the edited C . These elements are generally highly conserved among species that maintain editing at this site. Interestingly, even species that have lost editing capacity often maintain similar cis-element sequences, suggesting that loss of editing is frequently due to changes in trans-factors rather than cis-element mutations .

Trans-factors involved:
Several pentatricopeptide repeat (PPR) proteins serve as trans-factors for chloroplast RNA editing. For ndhG editing, OTP82 has been identified as a critical trans-factor in Arabidopsis thaliana, recognizing two editing sites including ndhG C50 . These PPR proteins contain specialized domains that interact with specific RNA sequences to facilitate the deamination of cytidine to uridine.

Experimental characterization approaches:

• Cis-element Mapping:

  • Generate a series of deletion and substitution constructs in the flanking sequences

  • Test editing efficiency using chloroplast transformation or in vitro editing assays

  • Define minimal sequence requirements through systematic mutagenesis

• Trans-factor Identification:

  • Perform RNA-protein pull-down assays using biotinylated RNA containing the editing site

  • Implement CRISPR-based knockout screens targeting predicted PPR proteins

  • Utilize reverse genetics to validate candidate factors

• Interaction Analysis:

  • Apply RNA Electrophoretic Mobility Shift Assays (EMSA) to quantify binding affinity

  • Employ Surface Plasmon Resonance to determine binding kinetics

  • Implement crosslinking and immunoprecipitation (CLIP) to map interaction sites in vivo

• Functional Reconstitution:

  • Establish in vitro editing systems with purified components

  • Test heterologous expression of trans-factors in editing-deficient backgrounds

  • Develop synthetic biology approaches to engineer novel editing specificities

These experimental approaches should incorporate controls using known editing sites and factors to validate methodologies and provide comparative data.

What strategies should be employed when designing experiments to study the impact of environmental stress on ndhG function?

Environmental stress studies on ndhG require rigorous experimental design with careful control of variables:

• Stress Application Protocols:

  • Implement precise control of stress intensity and duration

  • Design gradual stress application to mimic natural conditions

  • Develop combined stress treatments reflecting ecological reality

  • Include recovery phases to assess resilience mechanisms

• Measurement Parameters:

  • Monitor both transcript and protein levels of ndhG

  • Assess editing efficiency under stress conditions

  • Quantify protein activity using in vivo and in vitro assays

  • Measure physiological parameters (photosynthetic efficiency, ROS production)

• Experimental Design Considerations:

  • Utilize factorial designs to evaluate interaction effects

  • Implement response surface methodology for optimization studies

  • Include appropriate biological replicates (n≥5) for statistical power

  • Employ time-course sampling to capture dynamic responses

• Control Systems:

  • Include transgenic lines with altered ndhG expression/function

  • Compare multiple genotypes with known variation in editing efficiency

  • Develop inducible expression systems for controlled manipulation

  • Include wild relatives with natural variation in ndhG sequence/function

• Data Integration Approach:

  • Correlate molecular changes with physiological responses

  • Apply multivariate analysis to identify key factors

  • Develop predictive models relating ndhG function to stress tolerance

  • Validate findings across multiple species or ecotypes

This comprehensive approach ensures that experiments yield mechanistically meaningful results while maintaining ecological relevance. Statistical optimization methods like response surface methodology with central composite design have proven effective for similar complex biological systems, with prediction accuracies exceeding 90% .

How can researchers effectively immobilize ndhG on magnetic nanoparticles for advanced biocatalytic applications?

Immobilization of ndhG on magnetic nanoparticles presents unique challenges requiring specialized approaches:

• Nanoparticle Selection and Synthesis:

  • Choose magnetite (Fe₃O₄) nanoparticles with high magnetic saturation (Ms)

  • Synthesize particles with controlled size (10-30 nm) for superparamagnetic properties

  • Employ thermal decomposition or microemulsion methods for uniform particle morphology

  • Consider biocompatible synthesis routes using plant extracts as reducing agents

• Surface Functionalization Strategies:

  • Modify surfaces with functional groups complementary to ndhG attachment chemistry

  • Implement silica coating (Fe₃O₄@SiO₂) for increased surface area and biocompatibility

  • Incorporate spacer molecules to reduce steric hindrance

  • Design oriented immobilization to maintain active site accessibility

• Immobilization Chemistry Options:

  • Covalent attachment via glutaraldehyde or carbodiimide chemistry

  • Affinity-based immobilization using His-tag/Ni-NTA interactions

  • Adsorption methods with optimized pH and ionic strength

  • Encapsulation in mesoporous structures with controlled pore size

• Optimization and Characterization:

  • Apply response surface methodology for multivariate optimization

  • Measure magnetic properties before and after immobilization to confirm retained superparamagnetism

  • Assess enzyme loading, activity retention, and operational stability

  • Characterize using TEM, FTIR, VSM, and enzyme activity assays

• Performance Evaluation:

  • Test reusability through multiple magnetic recovery cycles

  • Determine thermal and pH stability compared to free enzyme

  • Measure catalytic efficiency with various substrates

  • Evaluate performance under realistic reaction conditions

Importantly, immobilization may reduce magnetic saturation (Ms) if biopolymer coatings impart diamagnetic qualities . For optimal performance, researchers should balance magnetic properties with enzyme activity, as excessive coating can shield magnetic response while insufficient coating may not adequately protect enzyme function.

What are the most challenging aspects of studying ndhG protein-ligand interactions, and how can these challenges be addressed?

Studying ndhG protein-ligand interactions presents several complex challenges requiring specialized approaches:

Table 2: Challenges and Solutions in ndhG Protein-Ligand Interaction Studies

For advanced structural studies, cryo-electron microscopy is particularly valuable for membrane proteins like ndhG, as it enables visualization in near-native states without crystallization. Computational approaches including molecular dynamics simulations in membrane environments can complement experimental data by providing atomic-level insights into binding mechanisms and conformational changes associated with catalysis.