Recombinant Manihot esculenta Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Manihot esculenta psbB

The psbB gene encodes the CP47 chlorophyll-binding protein, a core antenna component of PSII responsible for stabilizing chlorophyll and facilitating energy transfer to the reaction center . Recombinant production involves heterologous expression in systems like E. coli or mammalian cells, enabling large-scale purification for structural, biochemical, or biotechnological studies .

Key Features of Manihot esculenta psbB

ParameterDetailsSource
UniProt IDB1NWH6
Protein LengthFull-length (1–508 amino acids)
Expression SystemMammalian cells or E. coli
TagNot specified (varies by production method)
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer, 50% glycerol, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles

Diagnostic and Biotechnological Uses

  • Antibody Development: Polyclonal antibodies targeting psbB (e.g., Agrisera AS04 038) enable detection of CP47 in Western blots or clear-native PAGE, aiding studies on PSII biogenesis and stress responses .

  • Stress Tolerance Research: Overexpression of psbB in transgenic plants could enhance drought tolerance by optimizing PSII efficiency, though direct evidence in cassava remains limited .

Challenges and Considerations

  • Post-Translational Modifications: Native psbB undergoes chloroplast-specific modifications (e.g., chlorophyll attachment), which may not be fully replicated in heterologous systems .

  • Tissue-Specific Regulation: In cassava, psbB expression is upregulated in roots under low potassium or salt stress, suggesting roles beyond photosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Manihot esculenta (Cassava) (Jatropha manihot)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VSPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPVTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function

A core component of the photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Manihot esculenta Photosystem II CP47 chlorophyll apoprotein (psbB)?

Manihot esculenta (Cassava) Photosystem II CP47 chlorophyll apoprotein, encoded by the psbB gene, is a crucial integral antenna protein of photosystem II. The protein is also known as "PSII 47 kDa protein" or "Protein CP-47" and plays an essential role in light harvesting and excitation energy transfer to the PSII reaction center. The protein contains 16 chlorophyll molecules whose specific arrangement facilitates efficient energy transfer . The full-length protein consists of 508 amino acids as identified in the UniProt database (accession number: B1NWH6) .

What expression systems are most effective for producing Recombinant Manihot esculenta psbB?

  • Vector selection: Use vectors containing strong promoters (T7 or tac) for membrane protein expression

  • E. coli strain optimization: BL21(DE3) or C41/C43(DE3) strains often yield better results for membrane proteins

  • Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) typically improve folding

  • Solubilization strategies: Membrane proteins require careful detergent selection (DDM, LDAO, or OG) for extraction

  • Purification approach: Two-step purification using affinity chromatography followed by size exclusion chromatography

This methodological framework has demonstrated improved yield and purity compared to traditional single-step approaches. Researchers should optimize each parameter based on their specific experimental requirements.

How should spectroscopic analysis be conducted to verify the functional integrity of recombinant psbB protein?

Spectroscopic analysis is essential for confirming that recombinant psbB retains its native structural and functional properties. A comprehensive verification protocol should include:

  • Absorption spectroscopy (350-750 nm range) to confirm chlorophyll binding, with characteristic peaks at approximately 440 nm and 670 nm

  • Circular dichroism to evaluate secondary structure integrity

  • Fluorescence emission spectroscopy (emission maxima around 680 nm when excited at 440 nm)

  • Time-resolved fluorescence to assess energy transfer capabilities

For quantitative assessment, researchers should establish a baseline using the following comparative data:

ParameterNative CP47Properly Folded RecombinantMisfolded Recombinant
Abs. 440/670 nm ratio1.2-1.31.1-1.4<1.0 or >1.5
Fluorescence max (nm)680±2680±3>685 or <675
Fluorescence lifetime (ps)200-250180-270<150 or >300
CD alpha-helix content (%)65-7060-70<50

These spectroscopic analyses should be performed immediately after purification and after storage to evaluate protein stability and functional integrity over time .

How do quantum mechanics/molecular mechanics (QM/MM) approaches contribute to understanding psbB chlorophyll excitation energies?

QM/MM approaches have revolutionized our understanding of chlorophyll excitation energies and energy transfer processes in photosystem proteins like psbB. When applying QM/MM to study psbB, researchers should:

  • Establish a complete computational model including the membrane environment, as isolated protein models yield significantly different results

  • Implement time-dependent density functional theory (TDDFT) with range-separated functionals for accurate excitation energy calculations

  • Account for the electrostatic effect of the protein environment on individual chlorophyll site energies

  • Calculate the excitation profile of all 16 chlorophylls to identify energy transfer pathways

Recent research using this methodological approach has identified that chlorophylls B3 and B1 in CP47 have the most red-shifted absorption profiles, contrary to previous hypotheses in the literature . This finding has significant implications for understanding the directionality of energy transfer within the photosystem II antenna complex and ultimately to the reaction center.

The QM/MM approach provides superior results compared to simpler computational methods because it captures the critical protein-pigment interactions that modulate excitation energies in these complex systems.

What are the challenges in analyzing site-directed mutagenesis results for psbB functional studies?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in psbB, but presents several methodological challenges that researchers must address:

  • Selection of mutation sites requires careful structural analysis of chlorophyll-binding residues and protein-protein interaction interfaces

  • Multiple mutations may be necessary to observe phenotypic effects due to functional redundancy

  • Mutations often affect protein stability before function becomes compromised, requiring careful distinction between these effects

  • Quantitative assessment of energy transfer efficiency changes requires sophisticated spectroscopic techniques

A systematic approach should include:

  • Progressive mutation analysis starting with conserved residues

  • Complementary spectroscopic methods (steady-state and time-resolved)

  • Correlation of spectroscopic data with structural information

  • Parallel analysis of protein stability and assembly into PSII complexes

Researchers should be particularly attentive to unexpected compensatory mechanisms that may mask the effects of specific mutations, necessitating comprehensive analysis beyond the primary experimental readouts.

How can time-resolved spectroscopy elucidate energy transfer pathways within the CP47 antenna complex?

Time-resolved spectroscopy represents one of the most powerful approaches for mapping energy transfer pathways within photosynthetic antenna complexes like CP47. When designing these experiments, researchers should consider:

  • Multiple excitation wavelengths to selectively target different chlorophyll populations

  • Ultrafast time resolution (femtosecond to picosecond) to capture primary energy transfer events

  • Both visible and infrared probe wavelengths to monitor electronic transitions and vibrational dynamics

  • Temperature-dependent measurements to distinguish between energy transfer mechanisms

The following experimental setup has proven particularly effective:

ParameterRecommended RangeRationale
Excitation wavelength430-440 nm, 660-680 nmTarget Soret and Qy bands
Probe wavelength range650-750 nmCover all chlorophyll emission
Time resolution100 fs - 1 nsCapture all relevant timescales
Temperature77K and 298KDistinguish homogeneous/inhomogeneous effects

What methodological approaches can resolve contradictions in psbB structural stability data from different experimental techniques?

Researchers frequently encounter apparently contradictory results when analyzing psbB structural stability using different experimental techniques. This methodological challenge can be addressed through:

  • Integration of multiple complementary techniques with different sensitivity to specific structural aspects

  • Careful control of experimental conditions to ensure comparability between methods

  • Development of unified analysis frameworks that explicitly account for technique-specific biases

  • Consideration of the hierarchical nature of protein structural stability

A systematic approach should include:

  • Thermal stability analysis using differential scanning calorimetry (DSC) and circular dichroism (CD) in parallel

  • Chemical denaturation with multiple denaturants (urea, guanidinium, thermal stress)

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map domain-specific stability

  • Correlation with molecular dynamics simulations to interpret experimental observations

This integrated approach helps resolve apparent contradictions by providing a comprehensive view of protein stability across different hierarchical levels of structure and under various perturbation conditions.

How does the structure and function of Manihot esculenta psbB compare to homologous proteins from other photosynthetic organisms?

Comparative analysis of psbB proteins across species provides valuable insights into evolutionary conservation and functional specialization. When conducting such analyses, researchers should consider:

  • Sequence alignment focusing on chlorophyll-binding residues and protein-protein interaction interfaces

  • Structural comparison of available crystal structures or homology models

  • Spectroscopic properties as they relate to adaptation to different light environments

  • Correlation with evolutionary relationships and ecological niches

The following table summarizes key comparative features:

SpeciesSequence Identity to M. esculenta (%)Key Structural DifferencesFunctional Specialization
Cyanobacteria70-75Fewer transmembrane helicesAdapted to higher light intensity
Algae80-85Similar core structureVariable peripheral chlorophylls
Higher plants90-98Highly conservedFine-tuned for specific light environments
Welwitschia mirabilis~92Minimal differences in chlorophyll-binding sitesAdapted to extreme environments

This comparative approach reveals that while the core structure of psbB is highly conserved across photosynthetic organisms, subtle variations in specific regions correlate with adaptation to different light environments and ecological niches .

How can researchers effectively isolate native psbB protein complexes from Manihot esculenta for comparative studies with recombinant protein?

Isolation of native psbB complexes from Manihot esculenta for comparative analysis with recombinant protein requires specialized methodologies:

  • Tissue selection: Young, fully expanded leaves yield optimal photosystem II components

  • Timing: Harvest in the morning after 2-3 hours of light exposure for maximal photosystem II assembly

  • Isolation buffer optimization: Plant-specific components to maintain membrane integrity

  • Membrane solubilization: Mild detergents (digitonin or β-DDM) at low concentrations

  • Separation techniques: Sucrose gradient ultracentrifugation followed by ion exchange chromatography

The isolation protocol should be tailored to Manihot esculenta's unique biology:

  • Account for high latex content in tissues that can interfere with isolation

  • Include specific protease inhibitors effective against cassava's endogenous proteases

  • Implement rapid processing to minimize degradation in this particularly labile system

  • Include multiple quality control steps (absorption spectroscopy, SDS-PAGE, immunoblotting)

This methodological approach enables direct comparison between native and recombinant proteins, providing insights into structural and functional fidelity of recombinant systems and potential artifacts introduced during recombinant expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.