Recombinant Manihot esculenta Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

The Recombinant Full Length Manihot esculenta Photosystem Q(B) Protein (UniProt ID: B1NWD0) is a recombinant version of the Photosystem II (PSII) D1 protein, expressed in E. coli with an N-terminal His tag for purification and structural studies . This protein plays a central role in oxygenic photosynthesis, functioning as the apoprotein for the quinone Q(B) binding site in PSII reaction centers (RCs) .

Functional Role in PSII

  • Q(B) Binding: Serves as the secondary quinone acceptor in PSII RCs, facilitating electron transfer from Q(A) to the cytochrome b6f complex .

  • Herbicide Target: The Q(B) pocket is a binding site for photosynthetic herbicides (e.g., diuron, terbuthylazine), which inhibit PSII activity .

Herbicide Binding Studies

The conserved Q(B) site in M. esculenta PSII aligns with structural data from cyanobacteria and plants, enabling predictive modeling of herbicide interactions . For example:

  • Terbutryn: Binds via hydrophobic interactions with residues in the Q(B) pocket (e.g., Phe265, Leu275) .

  • Affinity Trends: Diuron, terbuthylazine, and metribuzin exhibit higher binding affinity (>10-fold) compared to bentazon and metobromuron .

Comparative Analysis with Other Species

ParameterM. esculenta (B1NWD0)Prochlorococcus marinus (A8G5N5)
Sequence Length344 aa345 aa
Key ResiduesHis215, Ser264His215, Ser264
Expression HostE. coliE. coli
Purity>90%>90%
Storage BufferTris/PBS + trehaloseTris/PBS + trehalose

While Prochlorococcus marinus PSII structures inform Q(B) site dynamics, direct studies on M. esculenta remain limited .

Expression and Purification

  • Expression System: E. coli ensures cost-effective production of the His-tagged protein .

  • Purification: Affinity chromatography using Ni-NTA resin leverages the His tag for high-purity isolation .

Challenges and Future Directions

  • Limited Plant-Specific Data: Most Q(B) site studies focus on cyanobacteria or model plants (e.g., Arabidopsis), necessitating further research on M. esculenta .

  • Herbicide Resistance: Mutations in psbA (e.g., Ser264Ala) may reduce herbicide efficacy, warranting monitoring in agronomic settings .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Manihot esculenta (Cassava) (Jatropha manihot)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, PSII's primary electron donor, and subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How should researchers handle and store recombinant Photosystem Q(B) protein to maintain its integrity?

For optimal handling and storage of recombinant Photosystem Q(B) protein, researchers should follow these guidelines:

  • Store the lyophilized protein at -20°C/-80°C upon receipt .

  • Aliquot the protein to avoid repeated freeze-thaw cycles, which can significantly reduce activity .

  • Working aliquots can be stored at 4°C for up to one week .

  • For reconstitution, briefly centrifuge the vial to collect contents at the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Addition of glycerol (5-50% final concentration) is recommended for long-term storage .

  • The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 .

These storage conditions are critical for maintaining the structural integrity and functional activity of the protein for experimental applications.

What methods can be used to verify the purity and identity of recombinant Photosystem Q(B) protein?

To verify the purity and identity of recombinant Photosystem Q(B) protein, researchers should employ multiple complementary techniques:

  • SDS-PAGE analysis to assess purity, which should exceed 90% for most research applications .

  • Western blotting using antibodies specific to either the His-tag or the Photosystem Q(B) protein.

  • Mass spectrometry for precise molecular weight determination and peptide mapping.

  • Spectroscopic analysis to evaluate the presence and integrity of cofactors.

  • Functional assays measuring electron transport activity or oxygen evolution.

What is the predicted subcellular localization of Photosystem Q(B) protein in cassava, and how does this relate to its function?

The Photosystem Q(B) protein in Manihot esculenta is predicted to be localized in the chloroplast, specifically in the thylakoid membrane . This localization is consistent with its function in photosynthesis. Subcellular localization predictions for the Photosystem Q(B) protein, along with other photosynthesis-related proteins in cassava, indicate chloroplast targeting .

The protein's thylakoid membrane localization positions it optimally for its role in the photosynthetic electron transport chain, where it functions in electron transfer from the primary electron acceptor (QA) to the secondary quinone acceptor (QB). This strategic positioning is essential for efficient photosynthetic electron flow and subsequent energy conversion processes.

How does the expression of the psbA gene compare between wild and cultivated cassava varieties, and what are the implications for photosynthetic efficiency?

Research indicates significant differences in photosynthetic gene expression patterns between wild and cultivated cassava varieties:

  • Cultivated cassava varieties show characteristics of C3-C4 intermediate photosynthesis, while wild cassava varieties typically exhibit C3 photosynthesis .

  • Analysis of transcriptomic data reveals that photosynthesis-related genes, including those in the photosystem complex, show differential expression patterns between cultivated and wild varieties .

  • Single-cell transcriptome studies indicate higher expression of photosynthetic genes in the vascular tissue of cultivated cassava leaves compared to mesophyll cells, suggesting specialized photosynthetic adaptations .

  • Systematic indel sites have been identified in photosynthesis-related genes between ancestral and cultivated varieties, along with increased copy numbers of certain gene families in cultivated cassava .

These differences likely contribute to enhanced photosynthetic efficiency in cultivated varieties, representing an evolutionary adaptation that has been selected during domestication. Understanding these differences can inform targeted breeding strategies for further improving cassava productivity.

What methodological approaches are most effective for studying the role of Photosystem Q(B) protein in response to abiotic stress conditions?

To effectively study the response of Photosystem Q(B) protein to abiotic stress conditions, researchers should consider the following methodological approaches:

  • Gene expression analysis:

    • Quantitative RT-PCR to measure psbA transcript levels under different stress conditions

    • RNA-Seq for genome-wide expression profiling to identify co-regulated genes

    • Time-course experiments to track expression changes during stress exposure and recovery

  • Protein analysis:

    • Western blotting to quantify protein abundance under stress conditions

    • Pulse-chase experiments to determine protein turnover rates

    • Post-translational modification analysis using mass spectrometry

  • Functional assays:

    • Chlorophyll fluorescence measurements to assess photosystem II efficiency

    • Oxygen evolution measurements to evaluate photosynthetic activity

    • Electron transport rate determinations

Research has shown that various abiotic stresses significantly affect photosynthetic gene expression in cassava. For example, under heat stress, photosynthesis-related genes show upregulation peaking at 24 hours after stress initiation, while combined stresses like shade-heat produce different expression patterns . These findings highlight the importance of studying the protein's response to stress in a time-dependent manner and considering multiple stress factors simultaneously.

How can co-expression network analysis be used to understand the regulatory mechanisms governing Photosystem Q(B) protein function in cassava?

Co-expression network analysis provides valuable insights into the regulatory mechanisms controlling Photosystem Q(B) protein function in cassava:

  • Identification of coordinated gene modules:

    • Analysis of cassava transcriptome under various conditions has identified distinct modules containing photosynthesis-related genes .

    • The Turquoise module, which includes photosynthetic genes, shows enrichment for the "carbon fixation in photosynthetic organisms" pathway .

  • Discovery of key transcription factors:

    • Several transcription factors regulate photosynthetic genes in cassava, including GATA1 (Manes.03G154500), YABBY1 (Manes.02G035700), Myb-like (Manes.15G163100), HY5 (Manes.12G040300), and MADS (Manes.10G099000) .

    • These transcription factors likely bind to promoter regions containing light-responsive cis-regulatory elements .

  • Integration with physiological data:

    • Correlation of expression patterns with photosynthetic measurements helps validate the functional significance of identified networks.

    • Analysis of diurnal rhythm and stress responses reveals temporal regulation patterns.

Researchers can apply this approach by:

  • Generating transcriptome data from multiple tissues, developmental stages, and stress conditions

  • Constructing co-expression networks using WGCNA or similar tools

  • Identifying hub genes and transcription factors

  • Validating predicted interactions through ChIP-seq or promoter-reporter assays

This systems biology approach provides a comprehensive view of the regulatory framework governing Photosystem Q(B) protein expression and function within the broader context of cassava photosynthesis.

What protein-protein interactions are critical for Photosystem Q(B) protein function, and how can they be experimentally validated?

The function of Photosystem Q(B) protein depends on specific interactions with other photosynthetic components. These interactions and validation methods include:

  • Critical protein-protein interactions:

    • Association with other Photosystem II core proteins

    • Interaction with the oxygen-evolving complex

    • Binding to electron transport components

    • Engagement with repair and assembly factors during turnover

  • Experimental validation methods:

TechniqueApplicationAdvantages
Co-immunoprecipitationPull-down of protein complexes using antibodies against Photosystem Q(B) proteinIdentifies native interactions
Yeast two-hybridScreening for direct protein interactionsHigh-throughput for multiple candidates
BiFC (Bimolecular Fluorescence Complementation)Visualization of interactions in plantaProvides spatial information
FRET/FLIMDetection of protein proximity in living cellsQuantitative, detects dynamic interactions
Crosslinking mass spectrometryIdentification of interaction sitesProvides structural details of interfaces
Surface plasmon resonanceQuantitative measurement of binding kineticsDetermines affinity constants
  • Validation strategy:

    • Initial screening using high-throughput methods

    • Confirmation with at least two independent techniques

    • Functional validation through mutagenesis of interaction interfaces

    • Correlation with physiological measurements

Understanding these interactions is crucial for elucidating the molecular mechanisms underlying photosynthetic efficiency in cassava and potentially engineering improved varieties with enhanced photosynthetic performance.

How might recombinant Photosystem Q(B) protein be used in synthetic biology approaches to enhance photosynthetic efficiency in crop plants?

Recombinant Photosystem Q(B) protein offers several opportunities for synthetic biology applications to enhance photosynthetic efficiency:

These approaches could potentially accelerate the natural evolutionary trend observed in cassava from C3 toward more efficient C3-C4 intermediate photosynthesis , providing a pathway to enhance productivity in cassava and potentially other crop species.

What are the key factors to consider when designing experiments to study the turnover and repair of Photosystem Q(B) protein in cassava?

When designing experiments to study Photosystem Q(B) protein turnover and repair, researchers should consider:

  • Experimental timeline:

    • The protein has a high turnover rate due to photodamage

    • Short-term experiments (minutes to hours) capture rapid repair processes

    • Longer-term studies (days) reveal acclimation responses

  • Light conditions:

    • Control light intensity, quality, and photoperiod precisely

    • Include high light treatments to accelerate photodamage

    • Consider fluctuating light regimes that mimic natural conditions

  • Protein synthesis inhibition:

    • Use of lincomycin or chloramphenicol to block chloroplast protein synthesis

    • Enables differentiation between repair and de novo synthesis

    • Allows measurement of damage rate independent of repair

  • Quantification methods:

    • Western blotting with specific antibodies for protein abundance

    • Pulse-chase labeling with isotopes for turnover rates

    • Mass spectrometry for detection of damaged forms

  • Physiological correlations:

    • Simultaneous measurement of photosynthetic parameters

    • Oxygen evolution rates to assess functional capacity

    • Chlorophyll fluorescence to monitor PSII efficiency

This experimental framework allows for comprehensive characterization of the dynamics of Photosystem Q(B) protein in response to environmental conditions and provides insights into mechanisms that could be targeted for improving photosynthetic efficiency.

What analytical techniques provide the most insight into the structural and functional characteristics of recombinant Photosystem Q(B) protein?

A comprehensive analytical approach combining multiple techniques provides the most complete understanding of recombinant Photosystem Q(B) protein:

Analytical TechniqueInformation ProvidedTechnical Considerations
X-ray crystallographyHigh-resolution 3D structureRequires protein crystals; challenging for membrane proteins
Cryo-electron microscopyNear-atomic resolution structure in native-like environmentSample preparation critical; suitable for larger complexes
Circular dichroism (CD)Secondary structure compositionRapid assessment of folding; limited structural detail
FTIR spectroscopySecondary structure and cofactor environmentsSensitive to buffer conditions; complementary to CD
Mass spectrometryExact mass, post-translational modifications, complex compositionSample preparation affects detection; high sensitivity
EPR spectroscopyRedox centers, radical formation, metal coordinationSpecialized equipment; provides unique functional insights
Time-resolved fluorescenceEnergy transfer kinetics, protein dynamicsRequires specific instrumentation; direct functional assessment
Oxygen evolution measurementsFunctional activity of the photosystemPhysiologically relevant; requires intact complexes
P680+ reduction kineticsElectron transfer ratesRequires specialized spectroscopy; direct functional measurement

For recombinant Photosystem Q(B) protein, which is typically supplied as a lyophilized powder , successful reconstitution into a functionally active form is a prerequisite for many of these analytical techniques. The protein should be handled according to recommended storage conditions and reconstituted in appropriate membrane mimetics if membrane-dependent functions are being studied.

How can researchers distinguish between direct effects on Photosystem Q(B) protein and secondary effects in cassava photosynthesis studies?

Distinguishing direct from secondary effects on Photosystem Q(B) protein requires a multi-faceted experimental approach:

  • Time-resolved experiments:

    • Direct effects typically occur more rapidly than secondary consequences

    • Sequential sampling reveals the order of events following treatment

    • Establishment of causality through temporal relationships

  • Isolated systems versus intact plants:

    • Studies with purified recombinant protein reveal direct biochemical effects

    • Thylakoid membrane preparations provide intermediate complexity

    • Whole-leaf or intact plant studies capture the complete physiological context

    • Comparison across these levels helps identify where effects originate

  • Multiple independent measurements:

    • Protein abundance (Western blot)

    • Gene expression (qRT-PCR)

    • Protein functionality (electron transport measurements)

    • Whole-system performance (gas exchange)

    • Correlation analysis across these parameters

  • Genetic approaches:

    • Site-directed mutagenesis of specific residues

    • Comparison with known functional mutants

    • Complementation studies

By systematically implementing these approaches, researchers can build a compelling case for direct versus indirect effects on Photosystem Q(B) protein function, leading to more accurate interpretations of experimental results and a clearer understanding of cassava photosynthesis.

What are the most common technical challenges when working with recombinant Photosystem Q(B) protein, and how can they be overcome?

Working with recombinant Photosystem Q(B) protein presents several technical challenges that researchers can address with specific strategies:

  • Protein stability issues:

    • Challenge: The protein is prone to denaturation during freeze-thaw cycles

    • Solution: Aliquot upon receipt and store working aliquots at 4°C for up to one week

    • Strategy: Add glycerol (5-50%) for long-term storage

  • Functional reconstitution:

    • Challenge: Maintaining native-like activity in recombinant preparations

    • Solution: Reconstitute in appropriate membrane mimetics (liposomes, nanodiscs)

    • Strategy: Include necessary cofactors and lipids found in thylakoid membranes

  • Aggregation problems:

    • Challenge: Protein aggregation during concentration or storage

    • Solution: Optimize buffer conditions (pH, ionic strength, additives)

    • Strategy: Monitor aggregation using dynamic light scattering or size-exclusion chromatography

  • Expression and purification:

    • Challenge: Low yield or inclusion body formation in E. coli

    • Solution: Optimize expression conditions (temperature, induction timing)

    • Strategy: Consider fusion partners that enhance solubility

  • Experimental artifacts:

    • Challenge: Distinguishing tag-related effects from native protein properties

    • Solution: Include tag-only controls and consider tag removal

    • Strategy: Compare multiple tag positions (N-terminal vs. C-terminal)

  • Comparative analysis with native protein:

    • Challenge: Validating that recombinant protein accurately represents native function

    • Solution: Compare key functional parameters with native protein isolated from cassava

    • Strategy: Perform rescue experiments in mutant systems

By anticipating these challenges and implementing appropriate solutions, researchers can maximize the utility of recombinant Photosystem Q(B) protein for investigations into cassava photosynthesis and potential applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.