Recombinant Manihot esculenta Valine N-monooxygenase 1 (CYP79D1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your preferred tag type in advance for prioritized development.
Synonyms
CYP79D1; Valine N-monooxygenase 1; Cytochrome P450 79D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-542
Protein Length
full length protein
Species
Manihot esculenta (Cassava) (Jatropha manihot)
Target Names
CYP79D1
Target Protein Sequence
MAMNVSTTIGLLNATSFASSSSINTVKILFVTLFISIVSTIVKLQKSAANKEGSKKLPLP PGPTPWPLIGNIPEMIRYRPTFRWIHQLMKDMNTDICLIRFGRTNFVPISCPVLAREILK KNDAIFSNRPKTLSAKSMSGGYLTTIVVPYNDQWKKMRKILTSEIISPARHKWLHDKRAE EADNLVFYIHNQFKANKNVNLRTATRHYGGNVIRKMVFSKRYFGKGMPDGGPGPEEIEHI DAVFTALKYLYGFCISDFLPFLLGLDLDGQEKFVLDANKTIRDYQNPLIDERIQQWKSGE RKEMEDLLDVFITLKDSDGNPLLTPDEIKNQIAEIMIATVDNPSNAIEWAMGEMLNQPEI LKKATEELDRVVGKDRLVQESDIPNLDYVKACAREAFRLHPVAHFNVPHVAMEDTVIGDY FIPKGSWAVLSRYGLGRNPKTWSDPLKYDPERHMNEGEVVLTEHELRFVTFSTGRRGCVA SLLGSCMTTMLLARMLQCFTWTPPANVSKIDLAETLDELTPATPISAFAKPRLAPHLYPT SP
Uniprot No.

Target Background

Function

Function: Involved in the biosynthesis of the cyanogenic glucosides linamarin and lotaustralin. This enzyme utilizes L-valine or L-isoleucine as substrates but not L-leucine, L-phenylalanine, L-tyrosine, D-valine, or D-isoleucine.

Database Links

KEGG: ag:AAF27289

Protein Families
Cytochrome P450 family
Subcellular Location
Microsome membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the epidermis, the next two cortex cell layers, the endodermis and the pericycle of leaf petioles. Strong expression around the laticifers among the phloem cells and in parenchymatic cells between the protoxylem and the metaxylem cells. In th

Q&A

What is CYP79D1 and what is its primary function in cassava metabolism?

CYP79D1 is a cytochrome P450 enzyme that functions as valine N-monooxygenase I in cassava (Manihot esculenta). It catalyzes two successive N-hydroxylations of L-valine, representing the first committed steps in the biosynthesis pathway of the cyanogenic glucoside linamarin . This enzyme is part of the CYP79 family of cytochrome P450 monooxygenases and plays a crucial role in the plant's production of defensive compounds.

The biochemical reaction catalyzed by CYP79D1 follows this pattern:
L-valine + 2 reduced [NADPH-hemoprotein reductase] + 2 dioxygen → (E)-2-methylpropanal-oxime + 2 oxidized [NADPH-hemoprotein reductase] + CO₂ + 3 H₂O

The initial N-hydroxylations produce N,N-dihydroxy-L-valine, which is extremely labile and spontaneously dehydrates. The resulting product then undergoes decarboxylation (either spontaneously or enzyme-catalyzed) to produce (E)-2-methylpropanal-oxime, which can spontaneously isomerize to the (Z) form .

How does CYP79D1 contribute to cyanogenic glycoside production in cassava?

CYP79D1 is a key enzyme in the biosynthetic pathway of cyanogenic glycosides in cassava. It catalyzes the conversion of L-valine to its corresponding oxime, which is subsequently metabolized further to produce linamarin, the predominant cyanogenic glycoside in cassava .

The pathway progresses as follows:

  • CYP79D1 converts L-valine to (E)-2-methylpropanal-oxime

  • The oxime is further metabolized by CYP71E enzymes to form a cyanohydrin

  • The cyanohydrin is glucosylated to form linamarin

  • Linamarin accumulates in cassava tissues, particularly leaves

Research using CRISPR/Cas9-mediated knockout of CYP79D1 has demonstrated that disruption of this gene leads to significantly reduced cyanogenic glycoside levels in cassava, confirming its essential role in cyanogenesis .

What is the relationship between CYP79D1 and CYP79D2 in cassava?

CYP79D1 and CYP79D2 are two highly similar valine N-monooxygenase enzymes in cassava that appear to have functionally redundant roles in cyanogenic glycoside biosynthesis. Both genes are coexpressed in cassava tissues, with high expression observed in the outer cortex, endodermis, and pericycle cell layers, as well as in tissues surrounding laticifers, xylem, and phloem cells in the petiole .

The presence of two apparently functional redundant CYP79 homologs most likely reflects cassava's allopolyploid nature . This genetic redundancy presents both challenges and opportunities for researchers:

FeatureCYP79D1CYP79D2
Primary substrateL-valineL-valine
Secondary substrate activityLower activity with L-isoleucineLower activity with L-isoleucine
Expression patternCo-expressed with CYP79D2 in multiple tissuesCo-expressed with CYP79D1 in multiple tissues
Evolutionary originLikely result of allopolyploidyLikely result of allopolyploidy
Target for engineeringSuccessfully targeted with CRISPR/Cas9Potential redundant target

This redundancy suggests that comprehensive reduction of cyanogenic glycoside content might require targeting both genes simultaneously in breeding or engineering programs.

What methods are most effective for recombinant expression of CYP79D1?

For successful recombinant expression of functional CYP79D1, researchers should consider the following methodological approaches:

  • Expression System Selection: Heterologous expression in yeast (Saccharomyces cerevisiae) systems offers advantages for cytochrome P450 enzymes due to the presence of endogenous NADPH-cytochrome P450 reductase. E. coli systems may require co-expression of reductase partners.

  • Vector Construction:

    • Clone the full-length CYP79D1 cDNA into an expression vector with an inducible promoter

    • Consider adding N-terminal modifications (truncation of membrane-binding domain) or fusion tags to improve solubility

    • Include appropriate selection markers and purification tags

  • Expression Optimization:

    • For yeast systems: Cultivate at lower temperatures (20-25°C) after induction

    • Supplement media with δ-aminolevulinic acid (precursor for heme synthesis)

    • Optimize induction timing and concentration

    • Consider microsomal preparation for enzyme activity assays

  • Activity Verification:

    • Use radiolabeled amino acids as substrates to detect CYP79 biochemical activity

    • Analyze products using HPLC, LC-MS, or GC-MS

    • Confirm formation of (E)-2-methylpropanal-oxime from valine substrates

The CYP79D1 recombinant protein can be used for in vitro enzymatic assays, structural studies, and inhibitor screening, providing valuable insights into cyanogenic glycoside biosynthesis and potential targets for cassava improvement.

How can CRISPR/Cas9 be effectively used to edit the CYP79D1 gene in cassava?

CRISPR/Cas9-mediated editing of CYP79D1 in cassava has been successfully demonstrated and involves several critical steps:

  • Target Site Selection:

    • Identify suitable gRNA targets within CYP79D1 exons using algorithms like CRISPOR

    • Perform off-target analysis using tools like Cas-OFFinder

    • In previous successful research, exon 3 of CYP79D1 on genomic locus LG13 was effectively targeted

  • Vector Construction:

    • Design complementary DNA oligonucleotides for the selected gRNA target

    • Anneal oligonucleotides and clone into a plant CRISPR-Cas9 vector digested with BsaI

    • Ensure the vector contains appropriate plant selection markers

  • Transformation Protocol:

    • Use Agrobacterium-mediated transformation of friable embryogenic calli

    • Cultivate cassava plants (e.g., TMS 60444) on appropriate media like Murashige and Skoog (MS) basal salt with vitamins, supplemented with 2% sucrose and 3 g/L gelrite at pH 5.8

    • Screen transformants using appropriate selection agents

  • Mutation Detection and Characterization:

    • Extract genomic DNA from putative transgenic plants

    • Amplify the targeted region using PCR

    • Sequence the amplicons to identify insertions, deletions (indels), or substitutions

    • Calculate editing efficiency by dividing the number of mutant lines by the total number of transgenic lines

  • Transgene Expression Verification:

    • Extract RNA and synthesize cDNA

    • Perform RT-PCR to detect Cas9 gene expression

    • Include appropriate internal controls (e.g., Actin-7)

Previous research achieved 100% editing efficiency with this approach, with all eight regenerated T0 plants showing mutations in the CYP79D1 gene . The most common mutations were 4-bp deletions located 3 bp upstream from the PAM site, likely caused by non-homologous end-joining (NHEJ) DNA repair .

What analytical methods can be used to measure cyanogenic glycoside levels in CYP79D1-edited cassava?

Several analytical approaches can be employed to accurately quantify cyanogenic glycoside levels in wild-type and CYP79D1-edited cassava:

  • HPLC-Based Quantification:

    • Extract cyanogenic compounds from fresh cassava tissues using appropriate buffers

    • Separate compounds on appropriate HPLC columns (typically C18 reverse phase)

    • Use linamarin standards to generate calibration curves

    • Calculate concentrations based on peak areas compared to standards

  • Total Cyanide Content Determination:

    • Convert cyanogenic glycosides to hydrogen cyanide through enzymatic hydrolysis

    • Capture released HCN in alkaline solutions

    • Quantify using colorimetric methods (e.g., König reaction with chloramine T and pyridine-barbituric acid)

    • Express results in mg/kg fresh weight

  • Mass Spectrometry Methods:

    • LC-MS/MS for highly sensitive detection of individual cyanogenic compounds

    • GC-MS for volatile cyanide derivatives

    • Direct MS methods for high-throughput screening

In CYP79D1-edited cassava, cyanide content was found to be drastically reduced compared to wild-type plants. Wild-type cassava contained 2.405-3.143 g/kg fresh weight of linamarin, while CYP79D1-knockout plants showed approximately 17.44 ± 2.482 mg/kg fresh weight - a reduction of approximately 99% . This significant difference validates the effectiveness of CYP79D1 targeting for reducing cyanogenic potential in cassava.

What are the phenotypic effects of CYP79D1 gene knockout in cassava?

The knockout of CYP79D1 in cassava produces several notable phenotypic effects:

  • Cyanogenic Glycoside Reduction:

    • Significant reduction in linamarin content (approximately 99% reduction compared to wild-type)

    • Decreased total cyanide levels in leaf tissues

  • Agronomic Traits:

    • No significant differences in plant height, leaf length, leaf breadth, petiole length, or number of leaves per plant compared to wild-type cassava

    • Development of thinner stems compared to non-transgenic lines

  • Pest Susceptibility:

    • Increased vulnerability to insect infestation

    • Leaf destruction observed between 4-6 months of greenhouse storage

    • Required insecticide treatment for continued growth

This phenotypic profile demonstrates that while CYP79D1 knockout effectively reduces cyanogenic potential, it also compromises the plant's natural defense mechanisms against insect herbivory. This trade-off highlights the evolutionary role of cyanogenic glycosides in cassava's defense strategy and presents an important consideration for breeding programs aiming to develop low-cyanide cassava varieties.

How does CYP79D1 expression vary across different cassava tissues and developmental stages?

CYP79D1 expression follows a specific pattern across cassava tissues and developmental stages:

  • Tissue-Specific Expression:

    • High expression in the outer cortex, endodermis, and pericycle cell layers

    • Elevated expression in tissues surrounding laticifers, xylem, and phloem cells in the petiole

    • Co-expressed with CYP79D2 in all examined tissues

  • Developmental Regulation:

    • Expression has been examined in the first fully unfolded leaf and its petiole in the shoot tip of 2-month-old cassava plants

    • Expression patterns appear to correlate with tissues that benefit from chemical defense

  • Environmental Responsiveness:

    • Expression may be influenced by environmental stressors and pest pressure

    • The coordinated expression with CYP79D2 suggests redundancy in the biosynthetic pathway

Understanding this expression pattern is crucial for targeted modification strategies and for predicting the consequences of genetic interventions in different tissue types and developmental contexts.

What is the evolutionary significance of CYP79D1 in cassava and related species?

The evolutionary significance of CYP79D1 in cassava can be understood through several perspectives:

  • Genetic Redundancy:

    • The presence of two functional CYP79 genes (CYP79D1 and CYP79D2) likely reflects cassava's allopolyploid nature

    • This redundancy may provide genetic robustness to maintain the important defensive function

  • Pathway Evolution:

    • The cyanogenic glycoside pathway is considered ancient, with the glucosinolate pathway having evolved from it

    • CYP79 enzymes catalyze the amino acid-to-oxime step in both pathways, suggesting orthologous relationships

  • Adaptive Significance:

    • The role in producing defensive compounds suggests strong selective pressure

    • The specific targeting of valine for cyanogenesis in cassava represents a specialized adaptation

    • The significant insect susceptibility observed in CYP79D1-knockout plants confirms the adaptive value of this enzyme in plant defense

  • Substrate Specificity Evolution:

    • While primarily acting on L-valine, CYP79D1 can also accept L-isoleucine as a substrate with lower activity

    • This substrate flexibility might represent an evolutionary intermediate state or adaptation

This evolutionary context provides important insights for researchers working on crop improvement strategies, particularly when considering the potential ecological consequences of reducing cyanogenic potential in cultivated cassava varieties.

How can recombinant CYP79D1 be used in biotechnological applications?

Recombinant CYP79D1 offers several promising biotechnological applications:

  • Metabolic Engineering Platforms:

    • Expression in heterologous hosts to produce valuable oximes and derivatives

    • Development of enzyme variants with altered substrate specificities

    • Creation of synthetic pathways for novel compound production

  • Enzyme Evolution and Engineering:

    • Directed evolution to develop CYP79D1 variants with enhanced catalytic efficiency

    • Structure-guided mutagenesis to modify substrate preference

    • Engineering of temperature stability or solubility for industrial applications

  • Biosensor Development:

    • Creation of enzymatic biosensors for amino acid detection

    • Development of screening tools for enzyme inhibitors

  • Comparative Biochemistry:

    • Use as a model system for studying P450 evolution and function

    • Comparison with other CYP79 family members to understand structure-function relationships

These applications extend beyond cassava improvement and could contribute to broader advancements in enzyme technology and metabolic engineering.

What strategies can optimize CRISPR/Cas9 targeting of CYP79D1 for improved efficiency?

To optimize CRISPR/Cas9 targeting of CYP79D1, researchers should consider these advanced strategies:

  • Enhanced gRNA Design:

    • Employ machine learning-based tools to predict highly effective gRNA sequences

    • Target conserved functional domains within CYP79D1

    • Consider chromatin accessibility at target sites

  • Multiplex Editing Approaches:

    • Simultaneously target CYP79D1 and CYP79D2 to overcome functional redundancy

    • Use multiple gRNAs targeting different exons within CYP79D1

    • Combine with targeting of downstream pathway enzymes for enhanced effect

  • Delivery Optimization:

    • Refine Agrobacterium-mediated transformation protocols for cassava

    • Explore direct delivery methods like biolistics for recalcitrant cultivars

    • Optimize selection protocols to increase recovery of edited events

  • Template-Guided Repair:

    • Provide repair templates to guide homology-directed repair (HDR)

    • Introduce specific mutations rather than relying on NHEJ-induced indels

    • Target specific amino acid residues critical for enzyme function

  • Base and Prime Editing:

    • Utilize base editing technology for precise C→T or A→G conversions

    • Employ prime editing for targeted insertions, deletions, or all possible base transitions

Previous research achieved 100% editing efficiency with conventional CRISPR/Cas9 targeting , but these advanced approaches could provide more precise control over the nature of mutations and potentially address challenges in different cassava cultivars.

What research gaps remain in understanding CYP79D1 structure-function relationships?

Several important knowledge gaps remain in our understanding of CYP79D1:

  • Structural Characterization:

    • No high-resolution crystal structure of CYP79D1 has been published

    • The exact binding mode of valine substrate remains undetermined

    • Structural basis for the two successive N-hydroxylations is not fully characterized

  • Catalytic Mechanism:

    • The precise decarboxylation mechanism remains unclear - it is still unknown whether this step is spontaneous or enzyme-catalyzed

    • Kinetic parameters for different substrates need further characterization

    • Structural determinants of substrate specificity between valine and isoleucine are not fully understood

  • Protein-Protein Interactions:

    • Potential interactions with other enzymes in the pathway remain unexplored

    • The specific reductase partners in cassava have not been fully characterized

    • Subcellular organization of the pathway enzymes requires further study

  • Regulatory Mechanisms:

    • Transcriptional and post-translational regulation of CYP79D1 remains poorly understood

    • Environmental factors affecting expression and activity need further investigation

    • Epigenetic regulation has not been extensively studied

Addressing these gaps would provide valuable insights for both fundamental understanding of plant metabolism and applied efforts in cassava improvement.

What are common challenges in measuring CYP79D1 enzyme activity and how can they be addressed?

Researchers working with CYP79D1 may encounter several technical challenges when assessing enzyme activity:

  • Enzyme Instability:

    • Challenge: Cytochrome P450 enzymes often show instability in vitro

    • Solution: Use fresh preparations, optimize buffer conditions (pH, salt, glycerol), and include protease inhibitors; consider microsomal preparations rather than purified enzyme

  • Product Detection Difficulties:

    • Challenge: The oxime products can be unstable and challenging to detect

    • Solution: Employ sensitive analytical methods like LC-MS/MS or derivatization approaches; use authentic standards for calibration

  • Low Activity in Heterologous Systems:

    • Challenge: Recombinant CYP79D1 may show reduced activity in non-native hosts

    • Solution: Co-express with appropriate reductase partners; optimize expression conditions; consider using plant microsomes for native activity studies

  • Multiple Reaction Products:

    • Challenge: Formation of both E and Z isomers of the oxime can complicate analysis

    • Solution: Develop chromatographic methods that separate isomers; understand the spontaneous isomerization kinetics

  • Substrate Availability:

    • Challenge: Specialized amino acid substrates may be expensive or difficult to obtain

    • Solution: Consider synthesizing labeled substrates in-house; develop miniaturized assays to reduce substrate requirements

These methodological considerations are critical for accurate characterization of CYP79D1 function and for screening potential inhibitors or engineered variants.

How can phenotyping approaches be optimized for CYP79D1-edited cassava plants?

Effective phenotyping of CYP79D1-edited cassava requires comprehensive approaches that address both biochemical and agronomic traits:

  • Cyanogenic Potential Assessment:

    • Standard Method: Quantify linamarin and total cyanide content in different tissues

    • Enhancement: Develop high-throughput screening methods using colorimetric assays or portable sensors

    • Temporal Consideration: Assess cyanide levels at multiple developmental stages

  • Agronomic Performance Metrics:

    • Standard Approach: Measure plant height, leaf characteristics, and tuber yield

    • Enhancement: Implement image-based phenotyping for non-destructive measurement of growth parameters

    • Context: Evaluate performance under both optimal and stress conditions

  • Pest and Pathogen Resistance:

    • Challenge: Low-cyanide cassava typically shows increased susceptibility to pests

    • Solution: Implement controlled insect challenge assays; quantify damage using standardized scales

    • Mitigation Strategy: Evaluate combination with other defense mechanisms or integrated pest management

  • Nutritional Quality Assessment:

    • Standard Method: Analyze starch content and quality in storage roots

    • Enhancement: Evaluate potential changes in nutritional composition beyond cyanide reduction

    • Processing Quality: Assess post-harvest characteristics relevant to food applications

  • Field Performance Validation:

    • Challenge: Laboratory phenotypes may not translate to field conditions

    • Solution: Conduct multi-location trials under farmer-managed conditions

    • Regulatory Consideration: Design trials in compliance with biosafety regulations for genetically modified crops

This comprehensive phenotyping strategy enables researchers to fully characterize the impacts of CYP79D1 editing and identify varieties that balance reduced cyanogenic potential with acceptable agronomic performance.

How can CYP79D1 gene editing be integrated with conventional cassava breeding programs?

Integrating CYP79D1 gene editing with conventional breeding requires strategic approaches:

  • Elite Germplasm Targeting:

    • Apply CRISPR/Cas9 editing to elite cassava varieties with desirable agronomic traits

    • Edit multiple genetic backgrounds to identify optimal combinations of low cyanide and high performance

    • Develop breeding values for edited lines through progeny testing

  • Marker-Assisted Selection Integration:

    • Develop molecular markers for tracking edited CYP79D1 alleles

    • Combine edited CYP79D1 with other important trait loci through marker-assisted breeding

    • Implement genomic selection to optimize genetic gain across multiple traits

  • Transgene-Free Development:

    • Select transgene-free segregants that retain the desired CYP79D1 edits

    • Characterize the inheritance and stability of edited alleles across generations

    • Address regulatory requirements for transgene-free edited varieties

  • Participatory Variety Selection:

    • Involve farmers in evaluating edited varieties under diverse growing conditions

    • Consider cultural preferences and processing requirements

    • Develop integrated management practices to address potential pest susceptibility

This integrated approach can accelerate the development of improved cassava varieties that maintain yield potential and stress tolerance while significantly reducing cyanogenic potential.

What complementary approaches can address the increased pest susceptibility of low-cyanide cassava?

The increased pest susceptibility observed in CYP79D1-edited cassava necessitates complementary approaches:

  • Alternative Resistance Mechanisms:

    • Stack edited CYP79D1 with genes conferring alternative insect resistance

    • Explore introduction of protease inhibitors or lectins for defense

    • Consider trichome engineering for physical resistance

  • Integrated Pest Management Strategies:

    • Develop specific IPM protocols for low-cyanide cassava

    • Optimize timing and selection of insecticide applications

    • Implement biological control strategies compatible with low-cyanide varieties

  • Agroecological Approaches:

    • Design intercropping systems that reduce pest pressure

    • Implement trap crops or repellent companion plants

    • Develop push-pull strategies specifically for low-cyanide cassava systems

  • Partial Reduction Strategies:

    • Consider targeting only one of the redundant genes (CYP79D1 or CYP79D2)

    • Engineer tissue-specific reduction of cyanogenic potential

    • Develop varieties with moderate rather than complete cyanide reduction

These complementary approaches can help balance the benefits of reduced cyanogenic potential with the maintenance of adequate pest resistance in improved cassava varieties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.