Recombinant Manihot esculenta Valine N-monooxygenase 2 (CYP79D2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP79D2; Valine N-monooxygenase 2; Cytochrome P450 79D2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Manihot esculenta (Cassava) (Jatropha manihot)
Target Names
CYP79D2
Target Protein Sequence
MAMNVSTTATTTASFASTSSMNNTAKILLITLFISIVSTVIKLQKRASYKKASKNFPLPP GPTPWPLIGNIPEMIRYRPTFRWIHQLMKDMNTDICLIRFGKTNVVPISCPVIAREILKK HDAVFSNRPKILCAKTMSGGYLTTIVVPYNDQWKKMRKVLTSEIISPARHKWLHDKRAEE ADQLVFYINNQYKSNKNVNVRIAARHYGGNVIRKMMFSKRYFGKGMPDGGPGPEEIMHVD AIFTALKYLYGFCISDYLPFLEGLDLDGQEKIVLNANKTIRDLQNPLIEERIQQWRSGER KEMEDLLDVFITLQDSDGKPLLNPDEIKNQIAEIMIATIDNPANAVEWAMGELINQPELL AKATEELDRVVGKDRLVQESDIPNLNYVKACAREAFRLHPVAYFNVPHVAMEDAVIGDYF IPKGSWAILSRYGLGRNPKTWPDPLKYDPERHLNEGEVVLTEHDLRFVTFSTGRRGCVAA LLGTTMITMMLARMLQCFTWTPPPNVTRIDLSENIDELTPATPITGFAKPRLAPHLYPTS P
Uniprot No.

Target Background

Function

Involved in the biosynthesis of the cyanogenic glucosides linamarin and lotaustralin. Utilizes L-valine or L-isoleucine as substrates.

Database Links

KEGG: ag:AAF27290

Protein Families
Cytochrome P450 family
Subcellular Location
Microsome membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the epidermis, the next two cortex cell layers, the endodermis and the pericycle of leaf petioles. Strong expression around the laticifers among the phloem cells and in parenchymatic cells between the protoxylem and the metaxylem cells. In th

Q&A

What is the biochemical function of CYP79D2 in the cyanogenic pathway of cassava?

CYP79D2 functions as a cytochrome P450 enzyme that catalyzes two key reactions in the biosynthetic pathway of cyanogenic glucosides:

  • The conversion of L-valine to (E)-2-methylpropanal-oxime in the linamarin biosynthesis pathway

  • The conversion of L-isoleucine to (1E,2S)-2-methylbutanal oxime in the lotaustralin biosynthesis pathway

Both reactions follow the same biochemical mechanism, requiring 2 molecules of reduced NADPH-hemoprotein reductase and 2 molecules of dioxygen as cofactors. The reactions produce the respective oximes along with 2 molecules of oxidized NADPH-hemoprotein reductase, CO₂, and 3 molecules of H₂O . This represents the first committed step in cyanogenic glucoside synthesis, making CYP79D2 a rate-limiting enzyme in the pathway. The oximes produced are subsequently converted to cyanohydrins by another cytochrome P450 enzyme (CYP71E7), and finally glycosylated by UDP-glucosyltransferases to form the cyanogenic glucosides linamarin and lotaustralin .

How do CYP79D1 and CYP79D2 paralogs differ functionally in cassava?

Despite their evolutionary relationship as paralogs, CYP79D1 and CYP79D2 have diverged significantly in their functional contributions to cassava cyanogenesis:

  • Contribution to cyanogen production: CRISPR-Cas9 knockout studies have revealed a stark functional difference between these paralogs. While knockout of CYP79D2 alone results in significant reduction of cyanide in cassava tissues, mutagenesis of CYP79D1 alone produces minimal effects on cyanogen levels . This indicates that CYP79D2 plays a more dominant role in cyanogenic glucoside biosynthesis.

  • Substrate specificity and efficiency: Both enzymes can use valine and isoleucine as substrates, but they may differ in their binding affinities or catalytic efficiencies. Studies have shown that the binding affinity is higher for valine than for isoleucine, which explains why linamarin (derived from valine) is the predominant cyanogenic glucoside in cassava rather than lotaustralin (derived from isoleucine) .

  • Genetic structure and expression: While both genes are expressed in cassava tissues, their relative expression patterns may vary across different tissues and developmental stages. Their sequence similarity has made targeting specific genes challenging, as "targeting CYP79D1 might inadvertently affect CYP79D2, contributing to the reduction of cyanogenic glycosides" .

These functional differences highlight the evolutionary divergence of these paralogs and provide valuable insights for targeted genetic engineering approaches aiming to reduce cassava cyanogenesis.

What methodology is used to produce and purify recombinant CYP79D2 for enzymatic studies?

To produce and purify recombinant CYP79D2 for enzymatic studies, researchers typically follow a methodological workflow that includes:

  • Gene isolation and cloning:

    • Extraction of RNA from cassava tissues (typically leaves where expression is highest)

    • Synthesis of cDNA using reverse transcription

    • PCR amplification of the CYP79D2 coding sequence using gene-specific primers

    • Cloning into an appropriate expression vector with suitable affinity tags (e.g., His-tag, GST-tag)

  • Expression systems:

    • Bacterial expression (typically E. coli) for basic enzymatic studies

    • Yeast expression (S. cerevisiae or P. pastoris) for functional cytochrome P450s requiring proper folding and membrane integration

    • Insect cell expression systems (baculovirus) for more complex eukaryotic processing

    • Plant expression systems (e.g., N. benthamiana) for surrogate assays and functional validation

  • Membrane protein solubilization:

    • As a cytochrome P450, CYP79D2 is a membrane-associated protein

    • Careful selection of detergents for solubilization without compromising activity

    • Alternatively, truncation of the N-terminal membrane anchor to create soluble variants

  • Purification techniques:

    • Affinity chromatography using the engineered tag (e.g., nickel columns for His-tagged proteins)

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography for further purification if needed

  • Activity validation:

    • Spectrophotometric assays to confirm proper heme incorporation and folding

    • Enzymatic assays using valine and isoleucine as substrates

    • Analysis of reaction products using methods such as LC-MS to confirm conversion to the expected oximes

Evidence from published studies indicates that enzymatic assays have been conducted using unpurified protein preparations , suggesting that complete purification may present challenges for maintaining full enzymatic activity of this membrane-associated cytochrome P450.

What analytical methods are most effective for measuring CYP79D2 activity and its products?

Several analytical methods have proven effective for measuring CYP79D2 activity and quantifying its reaction products:

  • Liquid Chromatography-Mass Spectrometry (LC-MS):

    • Provides high sensitivity and specificity for detecting and quantifying oximes and cyanogenic glucosides

    • Enables separation of structurally similar compounds like linamarin and lotaustralin

    • Has been successfully employed to measure linamarin and lotaustralin in leaves of wild-type and CYP79D2-edited cassava plants

    • Multiple reaction monitoring (MRM) can be used for targeted quantification of specific metabolites

  • Spectrophotometric assays:

    • Monitoring NADPH consumption at 340 nm can provide real-time kinetic data on enzymatic activity

    • Specialized P450 assays measuring the carbon monoxide-binding spectrum can confirm proper folding

  • Picrate assays for cyanide detection:

    • While not directly measuring CYP79D2 activity, picrate assays provide a colorimetric method for quantifying the end product of the pathway (cyanide)

    • This method has been effectively used to measure cyanide levels in leaves and tuberous roots of wild-type and mutant cassava plants

    • The intensity of the color change correlates with cyanide concentration, allowing quantification

  • Gas Chromatography (GC) for volatile oximes:

    • Can be used to detect and quantify the oxime products directly

    • Often coupled with mass spectrometry (GC-MS) for improved specificity and structural confirmation

  • Radioisotope assays:

    • Using 14C-labeled amino acid substrates (valine or isoleucine) can provide high sensitivity

    • Allows tracking of the conversion through the entire pathway

For comprehensive analysis of CYP79D2 function, researchers often employ multiple complementary methods. For instance, in vivo studies typically use picrate assays or LC-MS to measure pathway endpoints, while in vitro enzymatic studies focus on direct measurement of oxime formation and substrate consumption.

How does substrate specificity of CYP79D2 influence the ratio of cyanogenic glucosides in cassava?

The substrate specificity of CYP79D2 plays a critical role in determining the ratio of different cyanogenic glucosides in cassava tissues:

Understanding the substrate specificity of CYP79D2 provides insight into the natural accumulation patterns of cyanogenic glucosides in cassava and offers potential targets for engineering altered cyanogenic profiles through protein engineering or metabolic flux manipulation.

What are the optimal CRISPR-Cas9 design parameters for targeting CYP79D2 while minimizing off-target effects?

Designing effective CRISPR-Cas9 systems for CYP79D2 editing requires careful consideration of several parameters to maximize on-target efficiency while minimizing off-target effects:

  • Guide RNA selection criteria:

    • Target unique regions that differ from CYP79D1 to prevent cross-targeting, as "targeting CYP79D1 might inadvertently affect CYP79D2, contributing to the reduction of cyanogenic glycosides"

    • Select guides with minimal predicted off-target sites across the cassava genome

    • Prioritize targeting exonic regions, especially those encoding catalytically important residues

    • Previous successful strategies used two gRNAs per gene with minimal off-target potential that were ~500 bp apart

  • Target site accessibility:

    • Consider chromatin state and DNA accessibility at potential target sites

    • Research has shown differential targeting efficiency, where "mutagenesis of targets 1A and 2B occurred at a higher frequency than of 1B and 2A" , suggesting that target site selection significantly impacts editing efficiency

  • Cas9 variant selection:

    • Consider high-fidelity Cas9 variants (e.g., eSpCas9, SpCas9-HF1, HypaCas9) that demonstrate reduced off-target activity

    • Base editors or prime editors may be appropriate for specific applications requiring precise modifications

  • Delivery optimization:

    • Agrobacterium-mediated transformation of friable embryogenic calli (FEC) has proven effective for cassava

    • Optimize transformation protocols for the specific cassava cultivar being edited

    • Consider transient expression systems to minimize genomic integration of Cas9

  • Validation protocols:

    • Implement thorough validation using surrogate systems like Nicotiana benthamiana before cassava transformation

    • Conduct whole genome sequencing of edited lines to identify any off-target mutations

    • Perform phenotypic and biochemical characterization to confirm the expected outcomes

  • Specific technical parameters:

    • gRNA length: Standard 20-nucleotide guides have been effective, but truncated guides may improve specificity

    • PAM selection: Target NGG PAM sites with favorable surrounding sequences

    • Cas9 expression levels: Carefully control expression to minimize off-target effects while maintaining on-target efficiency

These optimization strategies can significantly enhance the precision and efficiency of CYP79D2 targeting, facilitating the development of acyanogenic cassava varieties without unintended genomic modifications.

How does the knockout of CYP79D1 versus CYP79D2 differentially impact cyanogen profiles across various cassava tissues and developmental stages?

Comprehensive analysis of CYP79D1 and CYP79D2 knockout effects reveals distinct patterns of impact across tissues and developmental stages:

These differential impacts provide valuable insights for targeted genetic engineering approaches, suggesting that CYP79D2 should be prioritized when the goal is significant cyanide reduction without complete elimination.

What mechanisms explain the compensatory metabolic responses in CYP79D2 knockout cassava plants?

When CYP79D2 is knocked out in cassava, several compensatory metabolic mechanisms appear to be activated, allowing the plant to maintain normal growth despite disruptions to cyanogenic glucoside biosynthesis:

  • Alternative nitrogen metabolism pathways:

    • Despite the role of cyanogenic glucosides in nitrogen storage, dual knockout plants (lacking both CYP79D1 and CYP79D2) displayed normal morphology when grown in nitrogen-limited media

    • This suggests activation of alternative nitrogen assimilation, storage, and mobilization pathways

    • Likely involves upregulation of glutamine synthetase/glutamate synthase (GS/GOGAT) pathway and other nitrogen metabolism enzymes

  • Metabolic flux redistribution:

    • The amino acid precursors (valine and isoleucine) normally channeled into cyanogenic glucoside synthesis become available for alternative metabolic fates

    • This may result in:

      • Increased protein synthesis

      • Enhanced branched-chain amino acid metabolism

      • Altered primary metabolite profiles

    • The absence of adverse effects suggests efficient redistribution of these metabolic resources

  • Transcriptional responses:

    • Knockout of CYP79D2 likely triggers transcriptional changes in related metabolic pathways

    • This could involve feedback regulation mechanisms responding to altered amino acid pools

    • Transcriptomic analysis would be valuable to fully characterize these compensatory changes

  • Stress response adaptations:

    • Cyanogenic glucosides serve protective functions against herbivores and some pathogens

    • Their reduction or elimination might activate alternative defense mechanisms

    • This could involve increased production of other secondary metabolites with defensive functions

  • Root-shoot communication:

    • Cyanogenic glucosides are thought to play a role in nitrogen transport between tissues

    • Their absence would necessitate alternative signaling and resource allocation mechanisms between leaves and storage roots

    • Hormonal signaling pathways may be modified to maintain proper source-sink relationships

How can protein engineering approaches modify CYP79D2 substrate specificity to alter cyanogenic glucoside profiles?

Protein engineering of CYP79D2 offers promising approaches to alter its substrate specificity and consequently modify cassava's cyanogenic glucoside profile without complete elimination:

  • Structure-based design strategies:

    • While a crystal structure of CYP79D2 is not currently available, homology modeling based on related cytochrome P450s can guide rational design

    • Key targets for modification include:

      • Substrate binding pocket residues that interact with the side chains of valine versus isoleucine

      • Amino acids in substrate access channels that control entry of different amino acids

      • Residues involved in positioning the substrate relative to the heme group

  • Site-directed mutagenesis approaches:

    • Targeted mutation of active site residues could:

      • Reduce affinity for valine to decrease linamarin production

      • Increase affinity for alternative amino acids to produce novel cyanogenic or non-cyanogenic products

      • Modify the catalytic efficiency ratio between different substrates

    • Conservative substitutions (e.g., between similar amino acids) may fine-tune rather than eliminate activity

  • Directed evolution methods:

    • Creating libraries of CYP79D2 variants through:

      • Error-prone PCR to introduce random mutations

      • DNA shuffling with related CYP79 family members

      • Focused randomization of key residues identified through structural analysis

    • Screening these libraries for variants with desired substrate specificity profiles

  • Domain swapping with related enzymes:

    • CYP79 family members from other plants utilize different amino acid substrates

    • Creating chimeric enzymes by swapping substrate recognition sites between CYP79D2 and related enzymes could generate novel specificities

    • This approach leverages natural diversity in the CYP79 family to engineer new functions

  • Implementation strategies:

    • Engineered variants could be introduced into cassava through:

      • CRISPR-Cas9 base editing to make precise changes to the endogenous gene

      • Transgenic approaches replacing the native gene with engineered variants

      • Promoter modifications to control expression levels of engineered variants

  • Validation methods:

    • In vitro enzymatic assays with purified variants to determine kinetic parameters with different substrates

    • Transient expression in model systems (e.g., N. benthamiana) to verify activity in planta

    • Analysis of cyanogenic profiles in transgenic cassava using LC-MS and picrate assays

This protein engineering approach offers a more nuanced alternative to complete gene knockout, potentially allowing the development of cassava varieties with customized cyanogenic profiles optimized for different agricultural and nutritional contexts.

What epigenetic factors regulate CYP79D2 expression during drought stress and how can they be manipulated?

Drought stress increases cyanogen production in cassava, a process likely mediated through epigenetic regulation of CYP79D2. Understanding and manipulating these epigenetic factors presents opportunities for developing drought-tolerant, low-cyanide cassava varieties:

  • DNA methylation dynamics:

    • Drought stress often alters DNA methylation patterns in stress-responsive genes

    • CYP79D2 promoter regions likely contain drought-responsive elements subject to methylation changes

    • Potential approaches for manipulation:

      • Targeted demethylation using CRISPR-dCas9 fused to TET1 catalytic domain

      • Application of demethylating agents like 5-azacytidine under controlled conditions

      • Selection of natural epigenetic variants with stable methylation patterns at the CYP79D2 locus

  • Histone modifications:

    • Drought-induced changes in histone acetylation and methylation can alter chromatin accessibility at the CYP79D2 locus

    • Key modifications likely include H3K4me3 (activation) and H3K27me3 (repression)

    • Manipulation strategies:

      • CRISPR-dCas9 fused to histone modifying enzymes (e.g., LSD1, p300) to target specific modifications

      • Small molecule inhibitors of histone deacetylases (HDACs) or methyltransferases

      • Engineering of drought-responsive histone modification machinery

  • Transcription factor interactions:

    • Drought-responsive transcription factors (e.g., DREB/CBF, bZIP, MYB) likely regulate CYP79D2

    • These interactions may be modulated by epigenetic marks

    • Potential manipulations:

      • Identification and modification of transcription factor binding sites in the CYP79D2 promoter

      • Engineering transcription factors with reduced sensitivity to drought signals

      • Development of transcription factor decoys to sequester drought-activated regulators

  • RNA-based regulatory mechanisms:

    • Drought stress may induce natural antisense transcripts or small RNAs targeting CYP79D2

    • These could be exploited or engineered for controlled expression

    • Approaches include:

      • Identification and enhancement of natural small RNAs targeting CYP79D2

      • Design of artificial microRNAs specifically targeting CYP79D2 under drought conditions

      • Engineering of drought-responsive RNA decay mechanisms

  • Experimental validation approaches:

    • Chromatin immunoprecipitation (ChIP) to map histone modifications at the CYP79D2 locus during drought

    • Bisulfite sequencing to characterize DNA methylation changes

    • ATAC-seq to assess chromatin accessibility alterations

    • RNA-seq to identify drought-responsive transcripts affecting CYP79D2 expression

By targeting these epigenetic regulatory mechanisms, researchers could potentially develop cassava varieties where CYP79D2 expression remains low even under drought stress, thus eliminating the problem of increased cyanide production during drought conditions that currently exacerbates food safety concerns . This approach would complement genetic knockout strategies while potentially offering more nuanced control over gene expression in response to environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.