Recombinant Manis tetradactyla NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include your specifications in the order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Manis tetradactyla (Long-tailed pangolin) (Uromanis tetradactyla)
Target Names
Target Protein Sequence
MSLVHINVMLAFIISLIGMLMYRSHLMSSLLCLEGMMLSLFTMMAITVLNINFTLASMTP IILLVFAACEAALGLSLLVLVSNTHGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does MT-ND4L from Manis tetradactyla differ from other species' homologs?

Comparative analysis shows that MT-ND4L from Manis tetradactyla shares varying degrees of homology with other species. When analyzing D-loop sequences, pangolin samples suspected to be from Manis pentadactyla showed approximately 90% homology with verified M. pentadactyla samples, while only 71.7-82.7% homology with M. tetradactyla .

This evolutionary divergence makes the protein valuable for:

  • Phylogenetic studies of pangolins

  • Species identification in wildlife forensics

  • Understanding the evolution of complex I structure and function

The following table summarizes key differences in homology between pangolin species:

Species comparisonHomology score rangeVariable sitesIndels
Suspected samples vs. M. tetradactyla71.7-82.7%22137
Suspected samples vs. M. pentadactyla~90%1309

What expression systems are most effective for producing recombinant MT-ND4L?

Recombinant MT-ND4L can be produced using several expression systems, each with specific advantages for different research applications:

  • Wheat germ cell-free system: Provides proper folding of membrane proteins like MT-ND4L and avoids toxicity issues often encountered in living cells. This system has been successfully used for expressing fragments of related proteins such as human ND4 .

  • Bacterial expression systems: While cost-effective, these systems may struggle with proper folding of mitochondrial membrane proteins.

  • Yeast expression systems: Particularly useful as they contain eukaryotic mitochondria that can facilitate proper processing and assembly of complex I components. Studies with Pichia pastoris have successfully expressed and characterized complex I subunits .

Methodologically, the optimal approach involves:

  • Codon optimization for the chosen expression system

  • Addition of purification tags (e.g., His-tag or HA-tag)

  • Use of specific detergents for membrane protein solubilization

  • Storage in glycerol-containing buffers at -20°C for stability

How can mutations in MT-ND4L affect mitochondrial function and contribute to disease?

Mutations in MT-ND4L can significantly impact mitochondrial function by disrupting:

  • Complex I assembly

  • Electron transport efficiency

  • Proton pumping across the inner mitochondrial membrane

  • Reactive oxygen species (ROS) production

The T10663C mutation (Val65Ala) in the human MT-ND4L gene has been linked to Leber hereditary optic neuropathy (LHON) . This mutation alters a single amino acid in a highly conserved region of the protein, affecting electron transport and potentially increasing oxidative stress in retinal ganglion cells.

Research methodology for studying these effects typically involves:

  • Site-directed mutagenesis to introduce specific mutations

  • Complex I activity assays using spectrophotometric methods

  • Measurement of ROS production

  • Assessment of mitochondrial membrane potential

  • Analysis of ATP synthesis rates

What techniques are most reliable for studying the incorporation of recombinant MT-ND4L into complex I?

Researching the incorporation of recombinant MT-ND4L into complex I requires sophisticated biochemical and imaging approaches:

  • Blue Native PAGE (BN-PAGE): Allows visualization of intact respiratory chain complexes and can detect altered assembly patterns when MT-ND4L is modified or absent.

  • Immunoprecipitation with antibodies against complex I subunits: Can determine whether recombinant MT-ND4L interacts with other subunits during assembly.

  • Confocal microscopy with fluorescently tagged MT-ND4L: Studies with human ND4 have shown that immunostaining can detect the protein as punctate fluorescent dots in the cytoplasm, excluded from nuclei and colocalizing with other mitochondrial proteins like ND6 .

  • Western blotting with epitope tags: Recombinant MT-ND4L can be tagged (e.g., with HA epitopes) for tracking in cellular systems. Studies with human ND4 showed successful detection of a ~54 kDa band (51.7 kDa for the protein plus ~2.7 kDa for three HA1 epitopes) .

  • Mass spectrometry: A combination of SDS-PAGE, HPLC, peptide mass fingerprinting, tandem MS, and molecular mass measurements has proven effective for characterizing complex I subunits in yeast systems .

How can allotopic expression of MT-ND4L be optimized for mitochondrial disease research?

Allotopic expression (nuclear expression of mitochondrial genes) represents a promising approach for treating mitochondrial diseases. Research with the related protein ND4 provides valuable methodological insights:

  • Optimization strategies:

    • Addition of a mitochondrial targeting sequence (MTS) from nuclear-encoded mitochondrial proteins like COX10

    • Incorporation of the 3'UTR from COX10 to enhance mRNA localization to the mitochondrial surface

    • Codon optimization to match nuclear expression patterns

  • Delivery systems:

    • Adeno-associated virus (AAV) vectors have shown efficacy in delivering human ND4 to retinal ganglion cells, with expression lasting up to 12 months

    • In vivo electroporation can be used to model mitochondrial dysfunction

  • Verification methods:

    • RT-qPCR to measure transcript levels (studies showed stable expression of human ND4 from 2 weeks through 14 weeks post-administration)

    • Western blotting with antibodies against epitope tags

    • Immunocytochemistry to verify mitochondrial localization

    • Functional assays to confirm integration into complex I and restoration of function

What molecular techniques are most effective for analyzing MT-ND4L sequence diversity in pangolin populations?

For researchers studying pangolin conservation and evolution, MT-ND4L sequence analysis provides valuable phylogenetic information:

  • DNA extraction protocols:

    • DNA can be successfully extracted from scales, tissues, and blood samples

    • For degraded samples (like seized scales), modified extraction protocols with extended lysis times are recommended

  • PCR amplification:

    • Primers designed for conserved regions flanking MT-ND4L

    • Research on pangolin D-loop sequences found that the PCR strategy developed could effectively identify scales suspected to be from protected species

  • Sequence analysis:

    • Multiple sequence alignment tools (MUSCLE, ClustalW)

    • Construction of neighbor-joining trees using the Kimura 2-Parameter model

    • Haplotype network analysis for population structure

  • Authentication methods:

    • Verification with multiple markers (cytochrome b, D-loop, CO1)

    • Phylogenetic comparison with reference sequences

    • Studies with Chinese pangolins revealed distinct haplotype groups that could be distinguished from African pangolin species

What controls should be included when evaluating recombinant MT-ND4L function in complex I assays?

Robust experimental design for MT-ND4L functional studies requires:

  • Positive controls:

    • Purified native complex I from the same or closely related species

    • Well-characterized recombinant subunits of complex I (e.g., NDUFA9, NDUFB8)

  • Negative controls:

    • Mutated MT-ND4L with known function-disrupting alterations

    • Samples treated with specific complex I inhibitors (rotenone, piericidin A)

    • Empty vector/expression system without MT-ND4L insertion

  • Technical controls:

    • ATP synthase subunits (e.g., ATP synthase α) for mitochondrial protein normalization

    • Varying concentrations of recombinant MT-ND4L to establish dose-response relationships

    • Time-course experiments to validate stability of the recombinant protein

  • Functional validation:

    • Oxygen consumption rate measurements

    • NADH oxidation assays

    • Membrane potential measurements using fluorescent dyes

How should researchers approach the purification of recombinant MT-ND4L to maintain structural integrity?

Purification of membrane proteins like MT-ND4L presents unique challenges:

  • Solubilization strategies:

    • Mild detergents (DDM, digitonin) to preserve native conformation

    • Lipid nanodisc incorporation for maintaining membrane environment

    • Glycerol addition (50%) in storage buffer for stability

  • Purification methods:

    • Affinity chromatography using epitope tags

    • Size exclusion chromatography for final polishing

    • Ion exchange chromatography to separate differentially charged species

  • Quality control assessments:

    • Circular dichroism to verify secondary structure

    • Mass spectrometry to confirm protein integrity and modifications

    • Dynamic light scattering to assess aggregation state

    • SDS-PAGE and Western blotting to verify purity and identity

  • Storage considerations:

    • Aliquoting to avoid freeze-thaw cycles

    • Storage at -20°C or -80°C for extended periods

    • Avoid repeated freezing and thawing, with working aliquots stored at 4°C for up to one week

What are the key considerations for designing experiments to study MT-ND4L interactions with other complex I subunits?

Understanding protein-protein interactions within complex I requires specialized approaches:

  • Crosslinking methodologies:

    • Chemical crosslinkers with varying spacer arm lengths

    • Photo-activatable crosslinkers for capturing transient interactions

    • Analysis of crosslinked products by mass spectrometry

  • Yeast two-hybrid adaptations:

    • Split-ubiquitin systems for membrane protein interactions

    • Bacterial two-hybrid systems as alternatives

  • Co-immunoprecipitation approaches:

    • Epitope-tagged MT-ND4L pulldowns

    • Antibodies against endogenous complex I subunits

    • Careful detergent selection to maintain interactions

  • Structural biology techniques:

    • Cryo-EM analysis of reconstituted complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Molecular dynamics simulations based on available structural data

How should researchers interpret differences in MT-ND4L sequences across pangolin species for conservation applications?

Interpretation of MT-ND4L sequence data for pangolin conservation requires:

  • Phylogenetic analysis frameworks:

    • Maximum likelihood and Bayesian methods to establish evolutionary relationships

    • Network analysis to visualize haplotype distributions

    • Studies found that Chinese pangolin (M. pentadactyla) samples formed distinct groups from samples of unknown origin with 99.17-100% identity to M. pentadactyla sequences

  • Conservation genetics metrics:

    • Calculation of genetic diversity indices (nucleotide diversity, haplotype diversity)

    • Population differentiation statistics (FST, GST)

    • Demographic history analysis (mismatch distribution, Tajima's D)

  • Forensic application guidelines:

    • Establishment of reference databases from verified samples

    • Statistical frameworks for species assignment probability

    • When analyzing seized pangolin scales, D-loop sequence homology to M. pentadactyla (~90%) was significantly higher than to M. tetradactyla (71.7-82.7%), enabling species identification

  • Data visualization approaches:

    • Unrooted neighbor-joining trees showing relationships between samples

    • Heatmaps of sequence similarity across species

    • Principal component analysis of genetic variation

What are the best practices for analyzing complex I activity data in experiments using recombinant MT-ND4L?

Rigorous analysis of complex I activity data requires:

  • Normalization strategies:

    • Protein concentration normalization

    • Activity ratios relative to other respiratory complexes

    • Comparison to citrate synthase activity as mitochondrial content marker

  • Statistical approaches:

    • Paired statistical tests for before/after comparisons

    • ANOVA with post-hoc tests for multiple experimental conditions

    • Non-parametric alternatives when data doesn't meet normality assumptions

  • Data presentation standards:

    • Activity measurements with clearly defined units

    • Error reporting with standard deviation or standard error

    • Sample size and replication details

  • Kinetic analysis methods:

    • Michaelis-Menten parameters calculation

    • Inhibition constant determination

    • Allosteric effects quantification

What are the future research directions for MT-ND4L studies in both basic science and translational applications?

Future research on MT-ND4L will likely focus on:

  • Structural biology advancements:

    • High-resolution structures of MT-ND4L within complex I

    • Conformational changes during electron transport

    • Species-specific structural variations

  • Therapeutic applications:

    • Gene therapy approaches using optimized allotopic expression

    • Small molecule modulators of MT-ND4L function

    • Gene editing strategies for mitochondrial diseases

  • Conservation applications:

    • Development of rapid DNA barcoding techniques for pangolin identification

    • Non-invasive sampling methods for endangered species monitoring

    • Comprehensive phylogeographic studies of pangolin populations

  • Biochemical mechanisms:

    • Proton pumping mechanisms involving MT-ND4L

    • Post-translational modifications affecting function

    • Assembly pathways for complex I incorporating MT-ND4L

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.