Recombinant Mannheimia succiniciproducens ATP synthase subunit a (atpB)

Shipped with Ice Packs

In Stock

Cat. No.

BT2131192

Source

in vitro E.coli expression system

Synonyms

atpB; MS2352; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6

Quick Inquiry

Description

Biological Role in Mannheimia succiniciproducens

AtpB is integral to the ATP synthase complex, which enables M. succiniciproducens to generate ATP under anaerobic, CO2-rich conditions—a hallmark of its capnophilic metabolism . Key functional insights include:

Energy Coupling: AtpB facilitates proton translocation across the membrane, driving ATP synthesis during succinic acid fermentation .
Metabolic Efficiency: ATP synthase activity supports high succinic acid yields (up to 134.25 g/L in engineered strains) by balancing redox states and energy demands .

3.2. Industrial Biotechnology

Succinic Acid Production: AtpB’s activity correlates with enhanced ATP availability, enabling high-flux succinic acid synthesis (productivity: 21.3 g/L/h) in engineered strains .
Cost-Effective Substrates: Optimized strains utilize whey and corn steep liquor, reducing production costs while maintaining yields >70% .

4.1. Dissolved CO2 Dependence

Cell growth and succinic acid production are proportional to dissolved CO2 concentrations (8.74–141 mM). At 141 mM CO2, biomass and succinic acid yields increase by 49% and 52%, respectively .
Critical Enzyme: Phosphoenolpyruvate carboxykinase (PckA) activity—linked to ATP synthesis via AtpB—is CO2-dependent, making dissolved CO2 a key process variable .

4.2. Metabolic Engineering Breakthroughs

Strain	Modification	Succinic Acid Yield	By-Products
Wild-Type	None	0.76 mol/mol glucose	Acetate, formate, lactate
LPK7	ΔldhA, ΔpflB, Δpta, ΔackA	1.16 mol/mol glucose	Negligible
cgmdh-OE	Overexpression of C. glutamicum MDH	134.25 g/L	None

Disrupting competing pathways (e.g., lactate dehydrogenase ldhA) redirects carbon flux toward succinic acid .
Heterologous expression of Corynebacterium glutamicum malate dehydrogenase (CgMDH) reduces substrate inhibition, boosting titers .

Future Directions

Dynamic Modeling: Genome-scale metabolic models (686 reactions, 519 metabolites) predict optimal CO2 and nutrient levels for industrial-scale production .
Enzyme Engineering: Rational design of AtpB to enhance proton translocation efficiency under low-pH conditions .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time

Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.

Shelf Life

Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.

Synonyms

atpB; MS2352; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-262

Protein Length

full length protein

Species

Mannheimia succiniciproducens (strain MBEL55E)

Target Names

atpB

Target Protein Sequence

MSGQTTSEYIGHHLQFLKTGDSFWNVHIDTLFFSVLAAIIFLAVFRSVAKKATSGVPGKL QCMVEILVEWINGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQLAGLFGI HYLRAVPTADISATLGMSLCVFALILFYTVKSKGFGGLVKEYTLHPFNHWSLIPVNFVLE SVTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANAAIAALGIPLHLAWAIFHILIVTL QAFIFMMLTVVYLSIAYNKAEH

Uniprot No.

Q65Q01

Target Background

Function

A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links

KEGG: msu:MS2352

STRING: 221988.MS2352

Protein Families

ATPase A chain family

Subcellular Location

Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Mannheimia succiniciproducens ATP synthase subunit a (atpB)

Description

Biological Role in Mannheimia succiniciproducens

3.2. Industrial Biotechnology

4.1. Dissolved CO2 Dependence

4.2. Metabolic Engineering Breakthroughs

Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service