Recombinant Mannheimia succiniciproducens Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to DsbB in Mannheimia succiniciproducens

DsbB is an inner membrane oxidoreductase that regenerates the disulfide bond carrier DsbA, enabling the continuous oxidation of substrate proteins in the bacterial periplasm. In M. succiniciproducens, a rumen bacterium engineered for industrial succinic acid production, DsbB ensures proper folding of virulence factors, transporters, and enzymes critical for anaerobic metabolism . The recombinant form is expressed in Escherichia coli for biochemical studies and industrial applications .

Primary Structure

The recombinant DsbB from M. succiniciproducens (UniProt ID: Q65VH4) is a 178-amino-acid protein with the following key features :

PropertyDetail
Amino Acid SequenceMLSFFKTLSMGRSGWLLLAFSALVLELVALYFQYGMQLQPCVMCVYERVALGGILFAGII... (Full length)
Molecular Weight~20 kDa (predicted)
Disulfide Bond PositionsCys residues at positions 41–44 and 104–130 (inferred from homologs)
Redox PotentialNot experimentally determined; homologs in E. coli: −69 mV (Cys41–Cys44)

Expression and Purification

  • Host System: E. coli .

  • Tag: N-terminal His-tag for affinity chromatography .

  • Purity: >85–90% (SDS-PAGE) .

  • Storage: Tris-based buffer with 50% glycerol; stable at −20°C/−80°C .

Research Applications

Recombinant M. succiniciproducens DsbB is utilized in:

  • Protein Engineering: Enhancing disulfide bond formation in heterologous proteins expressed in E. coli .

  • Metabolic Studies: Investigating redox homeostasis in M. succiniciproducens during succinic acid fermentation .

  • Antimicrobial Resistance Research: Targeting DsbB to disrupt virulence factor folding in pathogenic Gram-negative bacteria .

Limitations and Future Directions

  • Knowledge Gaps: No direct structural or kinetic data exist for M. succiniciproducens DsbB; current models rely on E. coli homologs .

  • Industrial Potential: Overexpression of DsbB could optimize folding of disulfide-rich enzymes in metabolic engineering strains .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will then prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time details.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; MS0429; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Mannheimia succiniciproducens (strain MBEL55E)
Target Names
dsbB
Target Protein Sequence
MLSFFKTLSMGRSGWLLLAFSALVLELVALYFQYGMQLQPCVMCVYERVALGGILFAGII GAIAPSSWFFRFLGIIIGLGASVKGFLLALKHVDYQLNPAPWNQCAYLPEFPQTLPLDQW FPYLFKPIGSCSDIQWSFLGFSMAQWILVMFAFYSILLAIILISQVKAGKPKHREIFR
Uniprot No.

Target Background

Function
This protein is essential for disulfide bond formation in some periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: msu:MS0429

STRING: 221988.MS0429

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant M. succiniciproducens dsbB production?

Based on available research data, E. coli expression systems have been successfully employed for recombinant production of M. succiniciproducens dsbB . When designing expression systems, researchers should consider:

  • Vector selection: Vectors containing strong inducible promoters (T7, tac) with appropriate fusion tags (typically His-tag at N-terminus) enhance expression and facilitate purification .

  • Host strain optimization: E. coli strains lacking endogenous dsbB (ΔdsbB) can prevent interference with recombinant protein function during functional assays.

  • Expression conditions: Induction at lower temperatures (16-25°C) may improve proper folding of membrane proteins.

  • Membrane protein solubilization: Standard protocols typically involve:

    • Cell lysis by sonication or pressure-based methods

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization using detergents (0.1% DM has been effective for DsbB proteins)

What purification strategies overcome challenges associated with membrane protein isolation?

Purification of membrane proteins like dsbB presents unique challenges. Research indicates successful purification approaches include:

  • Detergent selection: Critical for maintaining protein stability and function. For DsbB proteins, dodecyl maltoside (DM) at 0.1% (w/v) has proven effective .

  • Affinity chromatography: His-tagged recombinant M. succiniciproducens dsbB can be purified using Ni-NTA resin with imidazole gradients for elution .

  • Buffer optimization: Tris/PBS-based buffers with 6% trehalose at pH 8.0 have been used successfully for storage .

  • Protein-stabilizing additives: Addition of glycerol (typically 50%) helps maintain protein stability during storage .

  • Storage considerations: Aliquoting and storage at -20°C/-80°C with minimized freeze-thaw cycles is recommended to maintain activity .

How can the enzymatic activity of recombinant M. succiniciproducens dsbB be assessed in vitro?

While specific assays for M. succiniciproducens dsbB are not detailed in the search results, established approaches for DsbB activity assessment include:

  • Fluorescence spectroscopy: This technique directly monitors the redox state of DsbB in solution without requiring denaturing precipitation or chemical modification steps .

  • Disulfide exchange kinetics: Using purified DsbA and quinones as electron acceptors to measure the rate of disulfide bond formation.

  • Mass spectrometry: MALDI-TOF mass spectrometry can be employed to analyze the number of alkylated thiols in DsbB, revealing the redox state of specific cysteine residues .

  • Functional complementation: For genetic validation, dsbB genes can be tested for their ability to complement E. coli dsbB mutants, as demonstrated by toluidine blue resistance assays in analogous systems .

What methodologies can determine the membrane topology and structure of dsbB?

Advanced structural characterization requires specialized techniques:

  • Cysteine accessibility methods: Selective labeling of accessible cysteines with thiol-reactive compounds can map membrane topology.

  • Proteolysis approaches: Limited proteolysis combined with mass spectrometry can identify exposed segments.

  • Computational predictions: Transmembrane prediction algorithms combined with homology modeling based on E. coli DsbB can provide structural insights.

  • Crystallography challenges: Due to the difficulties in crystallizing membrane proteins, researchers often employ:

    • Detergent screening

    • Lipidic cubic phase crystallization

    • Fusion with crystallization-promoting domains

  • Water-soluble variants: Research on E. coli DsbB demonstrates that creating water-soluble variants through protein engineering can facilitate structural studies .

How does dsbB contribute to the metabolic capabilities of M. succiniciproducens?

M. succiniciproducens is primarily studied for its ability to produce succinic acid efficiently under anaerobic conditions . While the specific role of dsbB in this process isn't directly addressed in the search results, research allows for evidence-based hypotheses:

  • Protein folding quality control: As a disulfide bond formation protein, dsbB likely ensures proper folding of periplasmic and secreted proteins containing disulfide bonds, including enzymes involved in nutrient uptake and metabolism.

  • Potential metabolic linkages: Research on E. coli DsbB shows connections to the respiratory chain through quinones . In M. succiniciproducens, this could influence redox balance during anaerobic fermentation.

  • Industrial relevance: In metabolically engineered M. succiniciproducens strains designed for enhanced succinic acid production, proper protein folding machinery likely contributes to stress tolerance and metabolic efficiency .

A recent genome-scale analysis of M. succiniciproducens revealed:

PropertyDetailsReference
Genome sizeComplete genome sequence available
Metabolic network686 reactions and 519 metabolites identified
Key metabolic featuresStrong PEP carboxylation, branched TCA cycle, non-PTS glucose uptake
Engineered productionLPK7 strain: 52.4 g/L succinic acid with 1.16 mol yield per mol glucose

How can dsbB be engineered for enhanced functionality in biotechnological applications?

Advanced protein engineering approaches for dsbB optimization could include:

  • Cysteine pair modifications: Research on E. coli DsbB has shown that the redox potentials of cysteine pairs significantly influence enzymatic activity . Similar modifications in M. succiniciproducens dsbB could enhance its oxidoreductase efficiency.

  • Transmembrane domain engineering: Evidence from studies on membrane proteins shows that GxxxG motifs are overrepresented in transmembrane domains and can enhance protein stability. Addition of glycine zippers (GZs) to transmembrane helices, similar to approaches used with DsbBΔC GZ variants, may improve protein stability .

  • C-terminal modifications: Removal of flexible C-terminal segments (as demonstrated with a 13-amino acid truncation in related proteins) might enhance stability without compromising function .

  • Fusion strategies: Creating chimeric proteins with solubilizing domains like ApoAI* has been shown to enhance membrane protein solubility in some systems .

How does M. succiniciproducens dsbB compare to Neisseria gonorrhoeae dsbB?

Comparative analysis provides insights into evolutionary conservation and functional specialization:

FeatureM. succiniciproducens dsbBN. gonorrhoeae dsbBReference
Length178 amino acids162 amino acids
Sequence similarity-Moderate homology
Expression systemE. coliE. coli
Tag positionN-terminal His-tagN-terminal His-tag
Storage bufferTris/PBS-based, 6% trehalose, pH 8.0Tris/PBS-based, 6% trehalose, pH 8.0

The amino acid sequence differences likely reflect adaptations to their respective bacterial membrane environments and substrate preferences. Both proteins can be expressed and purified using similar methodologies, suggesting conserved structural properties despite sequence divergence .

What insights from E. coli DsbB research can be applied to M. succiniciproducens dsbB studies?

E. coli DsbB has been extensively characterized, providing valuable frameworks for M. succiniciproducens dsbB research:

  • Mechanistic insights: E. coli DsbB research has revealed detailed mechanisms of disulfide bond formation, including the role of specific cysteine pairs (41-44 and 104-130) and interaction with quinones in the respiratory chain .

  • Structural studies: The membrane topology and structure of E. coli DsbB can guide investigations of M. succiniciproducens dsbB, particularly regarding transmembrane domains and periplasmic loops .

  • Functional assays: Established methods for E. coli DsbB activity measurement, including fluorescence spectroscopy and mass spectrometry approaches, can be adapted .

  • Antibody development: Successful production of recombinant antibodies against E. coli DsbB provides methodological frameworks for developing specific antibodies against M. succiniciproducens dsbB .

How might M. succiniciproducens dsbB function differ in relation to the organism's capnophilic nature?

M. succiniciproducens is characterized as a capnophilic (CO2-loving) bacterium that efficiently produces succinic acid under anaerobic conditions in the presence of CO2 . This unique metabolic feature raises intriguing questions about potential adaptations in its protein folding machinery:

  • Redox environment adaptations: The anaerobic, CO2-rich environment of the bovine rumen may have selected for specific properties in the disulfide bond formation system to function optimally under these conditions.

  • Potential regulatory connections: The Arc two-component signal transduction system in M. succiniciproducens has been shown to differ from E. coli in terms of the signaling molecules and modes of kinase regulation . Similar specialized regulatory mechanisms might influence dsbB function.

  • Research approach: Comparative analysis of dsbB activity under varying CO2 concentrations and redox conditions could reveal environment-specific adaptations not present in non-capnophilic bacteria.

What role might dsbB play in pathogen-host interactions in related Mannheimia species?

While M. succiniciproducens is not typically pathogenic, research on the related pathogen Mannheimia haemolytica provides context for understanding potential roles of dsbB in bacterial-host interactions:

  • Virulence factor processing: M. haemolytica is a major cause of bovine respiratory disease (BRD) and produces various virulence factors, including leukotoxin1 . Many virulence factors require proper disulfide bond formation for activity, suggesting a potential role for dsbB in pathogenicity.

  • Bacterial invasion processes: Recent research demonstrates that pathogenic serotype A1 M. haemolytica can invade and replicate within bovine airway epithelial cells . The proper folding of invasion-associated proteins likely depends on functional disulfide bond formation systems.

  • Research implications: Comparing dsbB sequences and functions between non-pathogenic M. succiniciproducens and pathogenic M. haemolytica could identify adaptations relevant to virulence and host interaction.

  • Experimental approach: Knockout studies of dsbB in M. haemolytica followed by invasion assays using differentiated bovine bronchial epithelial cells could determine its contribution to pathogenicity.

How can researchers overcome protein aggregation issues when working with recombinant M. succiniciproducens dsbB?

Membrane protein aggregation is a common challenge. Research insights suggest several approaches:

  • Detergent optimization: Screening multiple detergents beyond the standard 0.1% dodecyl maltoside (DM) is recommended. Evidence from similar membrane proteins suggests that detergent mixtures sometimes outperform single detergents .

  • Buffer composition: The standard Tris/PBS-based buffer with 6% trehalose at pH 8.0 has proven effective, but systematic pH screening (pH 6.5-8.5) may identify optimal conditions for specific applications .

  • Solubilization strategies: Research on related membrane proteins indicates that addition of glycerol (5-50%) and use of stabilizing agents like arginine can significantly reduce aggregation .

  • Protein engineering solutions: Techniques demonstrated with DsbB variants include:

    • Addition of solubilizing fusion partners

    • Introduction of glycine zipper motifs in transmembrane domains

    • Truncation of flexible terminus regions

What quality control methods ensure functional integrity of purified recombinant dsbB?

Comprehensive quality assessment should include:

  • Purity analysis: SDS-PAGE with protein-specific staining, where >90% purity is typically required for functional studies .

  • Redox state assessment: Mass spectrometry to determine the oxidation state of critical cysteine residues .

  • Structural integrity: Circular dichroism spectroscopy to confirm proper secondary structure content, particularly important for alpha-helical membrane proteins.

  • Functional validation: Activity assays measuring disulfide bond formation capacity using model substrates and appropriate electron acceptors.

  • Oligomeric state determination: Size-exclusion chromatography to ensure the protein exists in the proper oligomeric state, as soluble aggregates have been observed in improperly prepared samples .

What emerging technologies could advance M. succiniciproducens dsbB research?

Several cutting-edge approaches show promise for deeper understanding:

  • Cryo-electron microscopy: This technique has revolutionized membrane protein structural biology and could provide high-resolution structures of M. succiniciproducens dsbB in near-native environments.

  • Nanodiscs technology: Reconstituting dsbB into nanodiscs represents a detergent-free system that better mimics the native membrane environment for functional studies.

  • Single-molecule FRET: This approach could reveal dynamic conformational changes during the catalytic cycle of dsbB that are not captured by static structural methods.

  • Genome-wide CRISPR screening: Systematic investigation of genetic interactions could identify previously unknown partners and regulatory networks affecting dsbB function.

  • Systems biology integration: Combining dsbB research with the existing genome-scale metabolic models of M. succiniciproducens (comprising 686 reactions and 519 metabolites) could reveal its broader impact on cellular physiology.

How might dsbB research contribute to sustainable bioproduction strategies?

M. succiniciproducens is primarily valued for sustainable succinic acid production. Future dsbB research could enhance these capabilities:

  • Stress tolerance engineering: Optimized disulfide bond formation systems could improve the robustness of engineered strains under industrial fermentation conditions.

  • Heterologous protein secretion: Enhanced understanding of dsbB could facilitate efficient secretion of recombinant proteins requiring disulfide bonds.

  • Substrate utilization expansion: Research shows M. succiniciproducens can utilize diverse carbon sources including whey and corn steep liquor . Properly folded substrate-specific transporters and enzymes, dependent on functional disulfide bond formation, could expand this versatility.

  • Integrated strain development: Recent metabolic engineering approaches have produced M. succiniciproducens strains like LPK7 capable of producing 52.4 g/L succinic acid with yields of 1.16 mol per mol glucose . Incorporating dsbB optimization could further enhance these properties.

What are the best approaches for developing antibodies against M. succiniciproducens dsbB?

Developing specific antibodies requires consideration of multiple factors:

  • Antigen design options:

    • Full-length recombinant protein in detergent micelles

    • Synthetic peptides corresponding to predicted periplasmic loops

    • Recombinant fragments excluding transmembrane domains

  • Production strategies: Recent advances in recombinant antibody technology, as demonstrated for E. coli DsbB antibodies, offer advantages including:

    • Increased sensitivity

    • Confirmed specificity

    • High repeatability

    • Excellent batch-to-batch consistency

    • Sustainable supply

    • Animal-free production

  • Validation techniques: Confirming antibody specificity through:

    • Western blotting against purified protein

    • Immunofluorescence microscopy in cells expressing tagged variants

    • ELISA-based binding assays

How can cross-species comparative analysis enhance understanding of bacterial disulfide bond formation systems?

Systematic comparative approaches yield valuable insights:

  • Phylogenetic framework: Constructing comprehensive evolutionary relationships among dsbB proteins from diverse bacterial species, including:

    • M. succiniciproducens (capnophilic, non-pathogenic)

    • M. haemolytica (pathogenic)

    • E. coli (well-characterized model)

    • N. gonorrhoeae (pathogenic)

  • Structure-function mapping: Identifying conserved vs. variable regions to pinpoint species-specific adaptations.

  • Horizontal gene transfer assessment: Analyzing whether dsbB genetic elements show evidence of horizontal acquisition.

  • Experimental validation: Heterologous expression studies testing functional complementation across species, similar to experiments demonstrating that the Arc system of M. succiniciproducens can functionally complement E. coli Arc mutants despite mechanistic differences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.