Mannheimia succiniciproducens is a capnophilic (CO₂-loving), gram-negative facultative anaerobic rumen bacterium that has gained considerable attention for its ability to efficiently produce succinic acid. This organism was originally isolated from the rumens of Korean cows and has demonstrated remarkable capacity to metabolize a diverse range of carbon sources, including pentose sugars (xylose), hexose sugars (fructose and glucose), and disaccharides (lactose, maltose, and sucrose) . The complete genome sequence of M. succiniciproducens has been determined, enabling genome-scale metabolic characterization and targeted engineering approaches for enhanced production of valuable biochemicals .
What sets M. succiniciproducens apart from many other industrial microorganisms is its natural propensity for producing succinic acid under anaerobic conditions in the presence of carbon dioxide. This bacterium possesses a strong reductive branch of the tricarboxylic acid (TCA) cycle, which is leveraged in industrial applications for the efficient production of various TCA intermediates and related chemicals . The organism's metabolism has been extensively studied using genome-scale metabolic models and elementary mode analysis accompanied with clustering (EMC analysis) to gain deeper insights into its metabolic characteristics that enable efficient succinic acid production .
M. succiniciproducens employs sophisticated metabolic pathways for carbon utilization. The organism can efficiently consume various carbon sources through specific transport systems, including the phosphotransferase system (PTS) for sugars like sucrose . The metabolism of these carbon sources ultimately feeds into the central carbon metabolic network, which includes the reductive branch of the TCA cycle where fumarate reductase plays a crucial role.
Research has revealed that M. succiniciproducens depends on fumarate reduction to transport electrons for ATP synthesis, highlighting the essential role of fumarate reductase in its energy metabolism . This dependency has significant implications for metabolic engineering efforts aimed at producing various chemicals through the reductive TCA cycle.
Fumarate reductase is a membrane-bound enzyme complex that catalyzes the reduction of fumarate to succinate in the reductive branch of the TCA cycle. This reaction is particularly important under anaerobic conditions, where it serves as a terminal electron acceptor in the respiratory chain. In M. succiniciproducens, fumarate reductase plays a pivotal role in the conversion of oxaloacetate to succinic acid through a series of three sequential reactions: malate dehydrogenase converts oxaloacetate to malate, fumarase converts malate to fumarate, and finally, fumarate reductase converts fumarate to succinate .
Recombinant production of M. succiniciproducens fumarate reductase subunit D enables detailed study of this protein and facilitates various applications in research and biotechnology.
Recombinant frdD protein can be produced using various expression systems, with Escherichia coli being a common host. The recombinant protein is often fused with affinity tags, such as a His-tag, to facilitate purification through affinity chromatography . The recombinant protein typically includes the full-length sequence (amino acids 1-114) to ensure complete functionality .
The purified recombinant protein is generally obtained with high purity (greater than 90% as determined by SDS-PAGE) and is available in lyophilized powder form. For optimal stability and activity, the protein is stored in appropriate buffer conditions, such as Tris-based buffer with 50% glycerol .
M. succiniciproducens has gained significant attention for its natural ability to produce succinic acid as a major fermentation product under anaerobic conditions. The fumarate reductase enzyme, including its subunit D, plays a critical role in this process.
The production of succinic acid in M. succiniciproducens follows a specific metabolic pathway:
Phosphoenolpyruvate (PEP) carboxylation: PEP is carboxylated to form oxaloacetate, primarily catalyzed by PEP carboxykinase, which was found to be the most important for anaerobic growth and succinic acid production among the three CO₂-fixing enzymes (PEP carboxykinase, PEP carboxylase, and malic enzyme) .
Conversion of oxaloacetate to succinate: This occurs through three sequential reactions:
This pathway represents a branch of the TCA cycle operating in a reductive manner under anaerobic conditions.
The fumarate reductase complex, including the frdD subunit, plays a dual role in M. succiniciproducens metabolism:
It catalyzes the reduction of fumarate to succinate in the reductive branch of the TCA cycle.
It participates in electron transport for ATP synthesis, with fumarate serving as a terminal electron acceptor under anaerobic conditions .
This dual function underscores the importance of fumarate reductase, and consequently its subunit D, in both the central carbon metabolism and energy generation in M. succiniciproducens.
The understanding of fumarate reductase and its subunits has facilitated metabolic engineering approaches to enhance succinic acid production and develop strains capable of producing other valuable compounds.
Additionally, elementary mode analysis accompanied with clustering (EMC analysis) has identified novel overexpression targets for improved succinic acid production. For instance, overexpression of the zwf gene has been shown to enhance succinic acid production in M. succiniciproducens . These approaches demonstrate the potential for rational engineering of M. succiniciproducens metabolism for industrial applications.
Beyond succinic acid, the metabolic capabilities of M. succiniciproducens have been harnessed for the production of other valuable compounds. For example, the organism has been metabolically engineered to produce malic acid, another four-carbon dicarboxylic acid of industrial importance .
This engineering involved reconstructing the metabolic pathway by eliminating fumarase to prevent malic acid conversion to fumarate, and reconstructing the respiration system by introducing dimethylsulfoxide (DMSO) reductase from Actinobacillus succinogenes to improve cell growth using DMSO as an electron acceptor . These strategies highlight the flexibility of M. succiniciproducens metabolism and the potential for developing various bioprocesses through metabolic engineering.
To better understand the unique characteristics of M. succiniciproducens frdD, it is valuable to compare it with similar proteins from other organisms. While the search results provide information about frdD from Shigella flexneri, this comparison offers insights into the conserved features and unique aspects of these proteins.
Table 1 presents a comparison of the amino acid sequences of fumarate reductase subunit D from M. succiniciproducens and S. flexneri.
| Characteristic | M. succiniciproducens frdD | S. flexneri frdD |
|---|---|---|
| Length | 114 amino acids | 119 amino acids |
| UniProt ID | Q65RZ8 | P0A8Q5 |
| Sequence | MVDQNPKRSNEPPVWLMFSAGGMVSGLAFPVLILILGILLPFGIISPDNIIAFSHHWFGK LVILALTIFPMWAGLHRLHHGMHDIKVHVPNGGLIFYGLAAVYSFIVLFAVIAI | MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI |
| Gene Name | frdD | frdD |
| Locus Name | MS1655 | SF4309, S4574 |
This comparison reveals both similarities and differences between the two proteins. While both proteins share the same gene name (frdD) and have similar lengths, there are notable differences in their amino acid sequences. These differences may reflect adaptations to the specific metabolic requirements and environmental conditions of each organism.
The study of M. succiniciproducens fumarate reductase subunit D and the broader metabolic capabilities of this organism continue to be active areas of research with significant implications for industrial biotechnology.
Current research on M. succiniciproducens focuses on several areas:
Systems metabolic engineering to develop strains with enhanced production capabilities for various chemicals
Understanding the detailed mechanisms of electron transport involving fumarate reductase
Exploration of alternative electron acceptors for anaerobic respiration
Development of novel bioprocesses for the production of industrially important chemicals
These research directions aim to leverage the natural capabilities of M. succiniciproducens for sustainable production of valuable biochemicals.
The industrial potential of M. succiniciproducens and its engineered derivatives is substantial. The organism's ability to produce high yields of succinic acid and other dicarboxylic acids makes it valuable for various applications:
Production of biodegradable polymers and plastics
Synthesis of pharmaceutical intermediates
Development of food additives and preservatives
Creation of green solvents and chemicals
The continued study and engineering of M. succiniciproducens fumarate reductase and related metabolic pathways will likely expand these applications and contribute to the development of more sustainable industrial processes.
KEGG: msu:MS1655
STRING: 221988.MS1655
Mannheimia succiniciproducens is a capnophilic succinic acid-producing bacterium isolated from the rumens of Korean cows (strain MBEL55E). This organism has gained significant attention in metabolic engineering research due to its ability to produce large amounts of succinic acid as a major fermentation product under anaerobic conditions in the presence of CO₂. The complete genome sequence of M. succiniciproducens provides a foundation for understanding its metabolic pathways and for developing strains with enhanced succinic acid production capabilities through targeted genetic modifications. In particular, genome-scale metabolic-flux analysis has revealed that phosphoenolpyruvate (PEP) carboxylation is a major CO₂-fixing step with direct relationship to succinic acid flux in its branched tricarboxylic acid cycle .
Fumarate reductase (FRD) plays a crucial role in the anaerobic metabolism of M. succiniciproducens by catalyzing the reduction of fumarate to succinate, which is a key step in the production of succinic acid. This enzyme is part of a metabolic pathway where oxaloacetate (formed by carboxylation of phosphoenolpyruvate) is converted to succinic acid through three sequential reactions catalyzed by malate dehydrogenase, fumarase, and finally fumarate reductase . In the presence of CO₂, this pathway becomes particularly important for succinic acid production, making fumarate reductase a critical enzyme for the organism's distinctive metabolic capability.
While fumarate reductase (FRD) catalyzes the reduction of fumarate to succinate, succinate dehydrogenase (SDH) catalyzes the reverse reaction. Despite this functional difference, membrane-bound FRDs and SDHs share significant similarities in their amino acid sequences and structures, with particularly high conservation in their catalytic subunits . In typical cellular contexts, FRD functions under anaerobic conditions using electron donors to reduce fumarate, whereas SDH operates aerobically, providing fumarate as a substrate in the tricarboxylic acid (TCA) cycle and transferring electrons to quinone as part of the respiratory chain . This distinction is particularly important when studying the directionality of carbon flux in M. succiniciproducens metabolism.
The fumarate reductase complex in many bacteria typically consists of multiple subunits, with the D subunit (frdD) often functioning as a membrane anchor for the enzyme complex. While the search results don't provide specific structural details of M. succiniciproducens frdD, comparative analysis with other bacterial species suggests that frdD likely plays a role in membrane association and potentially in electron transfer pathways. Based on research with other organisms, fumarate reductase complexes can vary significantly, as demonstrated by the novel five-subunit soluble NADH-dependent FRD discovered in Hydrogenobacter thermophilus . In contrast to typical membrane-bound FRDs, this enzyme shows distinctive evolutionary characteristics and subunit organization. Understanding the specific structure and function of M. succiniciproducens frdD requires targeted structural and functional studies.
When expressing recombinant M. succiniciproducens frdD, researchers should consider several key experimental factors:
Expression System Selection: Choose between prokaryotic (E. coli) or eukaryotic expression systems based on post-translational modification requirements.
Vector Design: Include appropriate promoters, selection markers, and fusion tags to facilitate purification.
Induction Conditions: Optimize temperature, inducer concentration, and induction duration.
Solubility Considerations: As frdD may be membrane-associated, expression strategies might need to address potential solubility issues through fusion partners or detergent solubilization.
When conducting such expression experiments, researchers must adhere to NIH Guidelines for research involving recombinant or synthetic nucleic acid molecules, particularly when the experiments involve:
The deliberate transfer of recombinant nucleic acid molecules into human research participants
The use of DNA or RNA derived from recombinant nucleic acid molecules
Synthetic nucleic acid molecules that meet specific criteria related to length, integration capacity, or replication potential
Fumarate reductase activity can be measured through several established protocols. Based on methodologies used for similar enzymes, the following assay approach is recommended:
Standard NADH-dependent FRD Assay:
Prepare an assay mixture containing buffer (e.g., 50 mM NaPO₄, pH 6.5), fumarate substrate (20 mM), and electron donor (0.2 mM NADH).
Preincubate the mixture at appropriate temperature (e.g., 37°C for mesophilic organisms, higher for thermophiles).
Initiate the reaction by adding the enzyme solution.
Monitor NADH oxidation spectrophotometrically at 340 nm, using an extinction coefficient of 6.2 mM⁻¹ cm⁻¹ .
For kinetic analysis, vary fumarate concentrations (0.01-20 mM) and NADH concentrations (0.03-0.2 mM) .
Succinate Production Measurement:
For direct product measurement, analyze succinate production by ion-exclusion chromatography.
Prepare reaction mixtures containing buffer, fumarate, appropriate electron donor, and enzyme.
Incubate under anaerobic conditions.
Quantify succinate by absorbance at 210 nm using appropriate HPLC columns (e.g., TSK-gel OApak-A ion-exclusion column) .
One unit of fumarate reductase activity can be defined as the amount of protein that oxidizes 1 μmol of NADH or produces 1 μmol of succinate per minute .
When genetically manipulating frdD in M. succiniciproducens, researchers should consider:
Genomic Context: Understanding the relationship between frdD and other genes in the fumarate reductase operon is crucial. Unlike some organisms where FRD genes cluster together, some bacterial species have FRD genes distributed throughout the genome .
Knockout Strategy: For gene disruption experiments, consider the potential polar effects on downstream genes.
Complementation Studies: Include appropriate controls when reintroducing modified frdD versions.
Metabolic Impact: Since FRD is part of a central metabolic pathway in M. succiniciproducens, modifications may have cascading effects on carbon flux and energy metabolism.
| Experimental Approach | Key Considerations | Potential Challenges |
|---|---|---|
| Gene Knockout | Homologous recombination efficiency | Metabolic imbalance |
| Point Mutations | Selection of conserved residues | Functional redundancy |
| Heterologous Expression | Codon optimization | Protein folding issues |
| Promoter Modifications | Expression level control | Regulatory interference |
The Framework for Reliable Experimental Design (FRED) provides a structured approach to designing and implementing robust research methodologies, particularly valuable for fumarate reductase studies. FRED consists of six steps that support planning, implementation, and analysis to establish factually accurate outcomes .
When applying FRED to frdD research, consider:
Planning Phase: Develop a clear experimental methodology that accounts for:
Implementation Phase: Execute the planned methodology with careful attention to:
Analysis Phase: Ensure proper interpretation of results through:
Systematic data examination
Validation through repeated testing
Assessment of result consistency
This framework addresses the lack of standardization in research methodologies and supports the peer-review process by ensuring transparency and reproducibility .
When designing experiments involving recombinant M. succiniciproducens frdD, the following controls are essential:
Negative Controls:
Empty vector transformants to control for background activity
Heat-inactivated enzyme preparations to establish baseline measurements
Reaction mixtures lacking substrate or electron donor
Positive Controls:
Wild-type fumarate reductase enzyme (if available)
Known functional homologs from related organisms
Commercial enzyme standards when applicable
Expression Controls:
Western blotting to verify protein expression
Activity assays with standardized substrates
Cellular fractionation to confirm proper localization
Specificity Controls:
Testing alternative substrates to confirm enzyme specificity
Inhibitor studies to validate catalytic mechanism
Mutant variants affecting catalytic residues
Contradictions in experimental data are inherent to complex biological systems and can arise at multiple levels. When encountering contradictory results in frdD research, consider analyzing the contradictions through the four-level framework described in contradictions theory :
Primary Contradictions (intrinsic to an element):
Inconsistent enzyme activity under seemingly identical conditions
Solution: Examine microenvironmental factors, enzyme stability, or preparation variability
Secondary Contradictions (between two or more elements):
Discrepancies between in vitro and in vivo frdD behavior
Solution: Investigate cellular context factors, metabolic regulation, or cofactor availability
Tertiary Contradictions (between new and old versions):
Different results between wild-type and recombinant frdD
Solution: Analyze expression tags, folding differences, or post-translational modifications
Quaternary Contradictions (among different activities):
Inconsistencies between frdD behavior in different experimental systems
Solution: Standardize protocols across systems and account for system-specific variables
When addressing contradictions, researchers should:
Document all experimental conditions comprehensively
Perform statistical analysis to determine significance of variations
Consider multiple hypotheses that might explain discrepancies
Design targeted experiments to specifically resolve contradictory observations
Kinetic studies of recombinant frdD require rigorous statistical analysis to derive meaningful parameters. Recommended approaches include:
Enzyme Kinetics Modeling:
Michaelis-Menten kinetics for substrate affinity (Km) and maximum velocity (Vmax)
Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for linear regression analysis
Non-linear regression for direct fitting to Michaelis-Menten equation
Inhibition Studies:
Competitive, non-competitive, or uncompetitive inhibition models
Dixon plots for inhibition constant (Ki) determination
Statistical Validation:
ANOVA for comparing multiple experimental conditions
Student's t-test for pairwise comparisons
Confidence interval calculations for kinetic parameters
| Parameter | Typical Analysis Method | Reporting Format |
|---|---|---|
| Km | Non-linear regression | Value ± standard error (mM) |
| Vmax | Non-linear regression | Value ± standard error (μmol min⁻¹ mg⁻¹) |
| kcat | Derived from Vmax | Value ± propagated error (s⁻¹) |
| kcat/Km | Calculated ratio | Value with error range (M⁻¹ s⁻¹) |
Engineering frdD variants presents several promising avenues for enhancing succinate production in M. succiniciproducens:
Protein Engineering Approaches:
Site-directed mutagenesis of catalytic residues to improve reaction kinetics
Directed evolution to select for variants with enhanced activity under industrial conditions
Chimeric constructs incorporating features from thermostable or highly active homologs
Metabolic Integration Strategies:
Regulatory Modifications:
Promoter engineering to increase expression levels
Removing allosteric regulation to maintain activity under varying metabolite concentrations
Developing inducible systems for controlled expression
Building on previous successes in metabolic engineering of M. succiniciproducens, where disruption of competing pathways (ldhA, pflB, pta, and ackA) eliminated by-product formation , targeted enhancement of frdD activity could further improve carbon flux toward succinate production.
Emerging analytical techniques offer new opportunities to elucidate structure-function relationships in frdD:
Structural Biology Approaches:
Cryo-electron microscopy for membrane protein complexes
Hydrogen-deuterium exchange mass spectrometry for dynamics studies
X-ray crystallography of engineered variants
Functional Genomics Techniques:
RNA-seq to understand transcriptional responses
Proteomics to identify post-translational modifications
Metabolomics to track metabolic flux changes
Advanced Enzyme Characterization:
Single-molecule enzymology to observe conformational changes
Transient kinetics using stopped-flow techniques
Isothermal titration calorimetry for binding studies
Computational Approaches:
Molecular dynamics simulations to predict effects of mutations
Quantum mechanics/molecular mechanics for reaction mechanism studies
Machine learning for predicting functional properties from sequence