Recombinant Mannheimia succiniciproducens Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Overview of Mannheimia succiniciproducens

Mannheimia succiniciproducens is a capnophilic, Gram-negative bacterium found in the rumen and is known for its efficient production of succinic acid . Metabolic engineering has enhanced its ability to produce succinic acid, with research focusing on understanding and manipulating its metabolic pathways .

Metabolic Engineering for Succinic Acid Production

M. succiniciproducens can utilize various carbon sources, including sucrose, for succinic acid production . Research has focused on genetically modifying M. succiniciproducens to optimize succinic acid production . This involves modifying genes responsible for by-product formation, such as acetic, formic, and lactic acids, to improve succinic acid yield .

Elementary Mode Analysis (EMA)

Elementary mode analysis, coupled with clustering, provides insights into the metabolic characteristics of M. succiniciproducens, enhancing succinic acid production . Overexpression of the zwf gene, identified through EMC analysis, has been shown to improve succinic acid production, especially when combined with heterologous NADPH-dependent mdh overexpression .

Mechanosensitive Channel of Large Conductance (MscL)

MscL in bacteria functions as an emergency release valve, discharging cytoplasmic solutes upon osmotic stress . Inappropriate opening of the MscL pore can be detrimental, making it a potential antibiotic target . Studies have identified compounds that modulate MscL, offering insights into channel gating mechanisms and suggesting MscL's viability as an antibiotic target .

MscL Modulation and Antibiotic Potential

Specific compounds can bind to and modulate MscL, influencing bacterial growth. For example, sulfonamide compounds have been identified that increase MscL gating, with one compound (011) showing specificity towards MscL without affecting the folate pathway . The binding site for these compounds includes the S1 helix, which interacts with a neighboring subunit, a region also found in other prokaryotic and eukaryotic channels .

MscL-Dependent Growth Inhibition

In E. coli cells, compounds like 011 exhibit MscL-dependent decreased growth, suggesting a specific interaction with the MscL channel . Other compounds, like cumene, exclusively affect cells expressing MscL, further supporting the specificity of MscL as a target .

Key Enzymes in Sucrose Metabolism

M. succiniciproducens uses specific enzymes for sucrose metabolism . MS0909, a sucrose 6-phosphate hydrolase, is a major enzyme for the hydrolysis of sucrose 6-phosphate . Mutants lacking MS0784 and MS0909 show negligible cell growth, indicating that these genes are essential for sucrose metabolism .

Succinic Acid Fermentation

M. succiniciproducens is utilized in succinic acid fermentation, converting various carbon sources into succinic acid . Metabolic engineering efforts have led to strains capable of producing succinic acid with minimal by-product formation .

Novel Compounds and MscL Activation

Research has identified novel sulfonamide compounds that specifically bind and modulate MscL, offering insights into channel gating mechanisms . These compounds increase MscL gating, with one compound not affecting the folate pathway, indicating a specific mode of action through MscL activation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; MS2196; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Mannheimia succiniciproducens (strain MBEL55E)
Target Names
mscL
Target Protein Sequence
MSFMKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVGDVVMPVLGILTGGVDFKDLKFV LAEAVGETPAVTLNYGLFIQNVFDFIIIAFAIFMMVKGINKLKKPVEEAPKGPTSEELLS EIRDLLKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links

KEGG: msu:MS2196

STRING: 221988.MS2196

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Mannheimia succiniciproducens and why is its mscL protein of interest to researchers?

Mannheimia succiniciproducens is a capnophilic (CO2-loving) gram-negative rumen bacterium that has gained significant attention due to its efficient production of succinic acid, an industrially important four-carbon dicarboxylic acid . The organism was isolated from bovine rumen and has been extensively studied for metabolic engineering applications .

The large-conductance mechanosensitive channel (mscL) from M. succiniciproducens is of particular interest as it belongs to a family of membrane proteins that respond to mechanical stimuli by changing their conformation. These channels play crucial roles in osmoregulation, protecting cells from lysis during hypoosmotic shock by releasing solutes when membrane tension increases . The mscL protein from M. succiniciproducens (UniProt ID: Q65QF7) consists of 128 amino acids and shares structural and functional similarities with other bacterial mechanosensitive channels .

Research methodological approach: Comparative genomic analysis and ortholog identification between M. succiniciproducens mscL and other bacterial mechanosensitive channels can establish evolutionary relationships and functional conservation. Functional studies comparing channel properties between species provide insights into adaptive mechanisms related to their native environments.

How is recombinant M. succiniciproducens mscL protein expressed and purified for research applications?

The recombinant M. succiniciproducens mscL protein is typically expressed in E. coli expression systems using the following methodology:

  • Gene cloning: The mscL gene (full length: 1-128 amino acids) is cloned into an expression vector with an N-terminal His tag .

  • Expression: The recombinant protein is expressed in E. coli under controlled conditions to optimize protein yield.

  • Purification: The protein is purified using affinity chromatography techniques, leveraging the His tag.

  • Storage: The purified protein is typically provided as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

For reconstitution, researchers should:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

Alternative expression approaches include fusion protein systems similar to those used for E. coli mscL, where the protein is expressed as a glutathione S-transferase fusion protein followed by thrombin cleavage to recover the native protein .

What experimental systems are optimal for functional characterization of recombinant M. succiniciproducens mscL protein?

The gold standard for functional characterization of mechanosensitive channels is the patch-clamp technique applied to reconstituted systems. Based on established methodologies for similar channels:

  • Liposome Reconstitution:

    • Purified mscL protein can be reconstituted into artificial liposomes

    • Typical lipid compositions include mixtures of phosphatidylcholine, phosphatidylethanolamine, and cholesterol

    • Protein:lipid ratios must be optimized (typically 1:200 to 1:2000 w/w)

    • Reconstitution by detergent dilution or dialysis methods

  • Electrophysiological Characterization:

    • Patch-clamp recordings from reconstituted proteoliposomes

    • Inside-out or outside-out patch configurations

    • Pressure application through the patch pipette to induce channel opening

    • Analysis of single-channel conductance and pressure sensitivity

  • Pressure Response Testing:

    • Establishment of pressure-response curves

    • Determination of threshold pressures for channel activation

    • Quantification of open probability as a function of applied pressure

  • Pharmacological Studies:

    • Testing channel blockers such as gadolinium (Gd³⁺)

    • Examination of effects of specific antibodies on channel function

When working with the reconstituted M. succiniciproducens mscL, it's essential to establish appropriate control experiments with liposomes lacking the protein to confirm that observed channel activity is specific to the reconstituted mscL.

How does the M. succiniciproducens mscL protein compare functionally to other bacterial mechanosensitive channels?

Comparative analysis of mechanosensitive channels across bacterial species reveals important insights into evolutionary conservation and functional adaptations:

SpeciesProtein LengthSequence Identity with M. succiniciproducens mscLKey Functional Differences
M. succiniciproducens128 aa100%Reference protein
E. coli136 aa~40-45% (estimated)Well-characterized; gating threshold ~10-12 mN/m
Psychrobacter sp.143 aaSimilar secondary structure elementsLonger protein with extended C-terminus

Functional differences may reflect adaptations to the native environment:

  • M. succiniciproducens as a rumen bacterium may have adapted its mscL to function in variable osmotic conditions

  • Channel conductance, ion selectivity, and pressure sensitivity thresholds often vary between bacterial species

  • The activation threshold of mscL channels correlates with the typical osmotic challenges faced in their native environments

Research methodology: Comparative electrophysiological analysis using identical reconstitution systems and patch-clamp protocols is crucial for valid functional comparisons between mscL proteins from different species.

What role does the mscL protein play in osmolysis susceptibility and how can this be exploited in research applications?

The mscL protein plays a critical role in protecting bacteria against osmotic lysis:

  • Mechanism of Protection:

    • During hypoosmotic shock, water influx increases cell volume and membrane tension

    • MscL channels open in response to increased membrane tension

    • Channel opening allows rapid efflux of solutes, reducing turgor pressure

    • This mechanism prevents cell lysis during osmotic downshock

  • Engineering Osmolysis Susceptibility:

    • Deletion of mscL genes increases cellular susceptibility to osmotic lysis

    • In C. necator, knocking out the mscL gene made cells significantly more susceptible to osmolysis

    • When mscL knockout was combined with increased halotolerance, >90% osmolytic efficiency was observed upon osmotic downshock

    • Similar strategy in E. coli BL21 through deletion of both mscL and mscS genes increased osmolysis susceptibility

  • Research Applications:

    • Cell lysis for recovery of intracellular products without mechanical disruption or reagent-based methods

    • Reduced energy demand and costs for downstream processing of biomolecules

    • Potential application for industrial enzyme and biopolymer production

    • Osmolysis as an alternative to conventional cell disruption methods

Methodological approach: For engineered osmolysis susceptibility, cells lacking mscL can be grown in media with elevated salt concentrations, then subjected to hypoosmotic shock by resuspension in distilled water, triggering cell lysis and release of cytoplasmic contents.

What experimental challenges arise when investigating the electrophysiological properties of M. succiniciproducens mscL in artificial membrane systems?

Researchers face several technical challenges when characterizing M. succiniciproducens mscL:

  • Protein Stability and Functionality:

    • Maintaining native protein conformation during purification and reconstitution

    • Avoiding protein aggregation and ensuring proper membrane insertion

    • Verifying that the His-tag or other fusion elements don't interfere with channel function

    • Establishing protein activity before and after reconstitution

  • Reconstitution Efficiency:

    • Optimizing protein:lipid ratios for successful incorporation

    • Controlling protein orientation in liposomes

    • Ensuring uniform distribution of channels in the membrane

    • Verifying successful reconstitution through biochemical or microscopic techniques

  • Patch-Clamp Technical Considerations:

    • Achieving high-resistance (gigaohm) seals on proteoliposomes

    • Applying controlled and reproducible pressure stimuli

    • Distinguishing channel activity from membrane artifacts

    • Managing noise in single-channel recordings

  • Data Analysis Complexity:

    • Determining pressure thresholds accurately

    • Calculating single-channel conductance from multi-channel patches

    • Analyzing sub-conductance states and kinetic properties

    • Developing mathematical models of channel gating behavior

Methodological solutions include:

  • Using fluorescently labeled proteins to monitor reconstitution efficiency

  • Employing pressure-clamp systems for precise control of applied forces

  • Using automated patch-clamp systems for higher throughput

  • Developing specialized analysis algorithms for complex channel behavior patterns

How can researchers leverage M. succiniciproducens mscL in synthetic biology and biotechnology applications?

The M. succiniciproducens mscL protein offers several opportunities for synthetic biology applications:

  • Biosensors and Responsive Systems:

    • Development of tension-sensitive biological switches

    • Creation of cells that respond to mechanical stimuli with programmed outputs

    • Design of pressure-responsive gene expression systems

    • Engineering of microfluidic biological sensing elements

  • Controlled Cell Lysis Systems:

    • Engineering inducible lysis systems for biotechnology applications

    • Developing strains with controllable product release mechanisms

    • Creating osmotically sensitive cells for timed release of biomolecules

    • Improving downstream processing for intracellular product recovery

  • Metabolic Engineering Applications:

    • Integration with M. succiniciproducens succinic acid production pathways

    • Development of stress-responsive metabolic control systems

    • Creation of cells with membrane tension-regulated metabolic fluxes

    • Potential for linking physical stress sensing to production pathways

  • Structural Templates for Channel Engineering:

    • Using mscL as a scaffold for designing novel mechanosensitive channels

    • Engineering channels with altered conductance or selectivity properties

    • Creating hybrid channels with synthetic sensing domains

    • Developing membrane proteins with novel gating mechanisms

Methodological approach: For synthetic biology applications, researchers can combine protein engineering techniques with systems biology approaches to integrate mechanosensitive elements into engineered biological systems with predictable responses to mechanical stimuli.

What is the relationship between M. succiniciproducens mscL and the organism's metabolic engineering potential for succinic acid production?

While mscL is not directly involved in central carbon metabolism, understanding the complete cellular system including membrane components is important for comprehensive metabolic engineering:

What are the most effective methods for studying the in vivo dynamics of M. succiniciproducens mscL protein in its native membrane environment?

Studying the native behavior of mscL in M. succiniciproducens requires specialized approaches:

  • Fluorescent Protein Tagging:

    • Genomic integration of fluorescent protein fusions (e.g., GFP-mscL)

    • Live-cell imaging of mscL localization and dynamics

    • Photobleaching recovery techniques to measure lateral mobility

    • Single-molecule tracking to observe channel clustering behavior

  • Patch-Clamp Electrophysiology:

    • Giant spheroplast preparation from M. succiniciproducens

    • Whole-cell or excised patch configurations

    • Measurement of native channel properties without reconstitution

    • Correlation of electrical activity with osmotic challenges

  • Proteomics-Based Approaches:

    • Quantitative membrane proteomics to measure mscL expression levels

    • Crosslinking mass spectrometry to identify interaction partners

    • Protein turnover studies to determine channel half-life

    • Comparison of mscL abundance under different growth conditions

  • Genetic and Phenotypic Analysis:

    • Generation of mscL knockout strains in M. succiniciproducens

    • Complementation studies with modified versions of mscL

    • Phenotypic assays for osmotic shock survival

    • Assessment of lysis susceptibility under controlled osmotic downshock conditions

  • Computational Modeling:

    • Molecular dynamics simulations of mscL in native-like membranes

    • Prediction of gating mechanisms based on membrane composition

    • Integration of experimental data with computational models

    • Simulation of channel behavior under various tension conditions

These methodological approaches provide complementary information about mscL function in its native context, allowing researchers to connect molecular mechanisms to physiological functions in M. succiniciproducens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.