Recombinant Mannheimia succiniciproducens Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

2.1. Conformational Dynamics

MsbA undergoes ATP-driven conformational changes to transport lipid A:

  • Inward-Facing State: Characterized by a large transmembrane portal that accommodates lipid A entry into the central cavity .

  • Outward-Facing State: Facilitates lipid A release into the periplasm via helix rearrangements that disrupt lipid-binding residues .

Cryo-EM and X-ray structures reveal:

  • A hydrophilic cavity coordinating lipid A’s phosphorylated glucosamines via residues Arg78, Arg148, and Lys299 .

  • A hydrophobic pocket that accommodates lipid A’s acyl chains .

2.2. Substrate Specificity

  • Primary Substrate: Lipid A (hexa-acylated, C12–C14 chains) .

  • Secondary Substrates: Phospholipids like phosphatidylethanolamine (PE), depending on lipid availability .

3.1. ATPase Activity

  • ATP hydrolysis is essential for lipid A transport, with ADP showing higher binding affinity than ATP .

  • Lipid A binding enhances ATPase activity ~2.5-fold, while mutations in key residues (e.g., R78A/R148A/K299A) abolish this stimulation .

3.2. Lipid Transport Energetics

  • Lipid A Transport: Solely ATP-dependent, requiring binding and hydrolysis .

  • Phospholipid Transport: Requires both ATP hydrolysis and a proton gradient .

Mutational and Functional Studies

MutationImpact on FunctionSource
R78A/R148A/R296ALoss of lipid A binding and ATPase stimulation
K299ARetains PE transport activity
D45N (NBD defect)Abolishes ATPase and transport functions

Research Applications

  • Antibiotic Development: As MsbA is essential for Gram-negative bacterial viability, it is a target for novel antibiotics .

  • Lipid Transport Studies: Used to probe ATP-dependent flipping mechanisms in synthetic membranes .

  • Structural Biology: Serves as a model for ABC transporter dynamics .

Key Challenges and Future Directions

  • Heterogeneity in Substrate Transport: The dual role in lipid A and drug efflux complicates mechanistic studies .

  • Expression Optimization: Improving recombinant yield and stability for structural studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
msbA; mdlB; MS0932; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Mannheimia succiniciproducens (strain MBEL55E)
Target Names
msbA
Target Protein Sequence
MQKLQENDLSTSQTFKRLWPTIAPFKIGLIAAAAALVLNALTDSGLIYLLKPLLDDGFGK ADTSFLKLMAVLVIVFIFIRGITSFISSYCLAWVSGKVVMTMRRRLFKHLMYMPVSFFDQ NSTGRLLSRITYDSEQVANSSSNALVTIVREGAYIISLLAVMIATSWQLSVVLFIIGPVI AVLIRLVSKIFRRLSKNMQNSMGELTATAEQMLKGHKVVLSFGGQQIEEQRFNEVSNDMR RKGMKMVVADAISDPIVQIIASLALSAVLYLATIPSIMSQNLSAGSFTVVFSSMLAMLRP LKSLTNVNSQFQRGMAACQTLFDILDLDTEKDKGKYEAERVKGDVSFKDVSFTYQGKDQP ALKHLSFDIPHGKTFALVGRSGSGKSTIANLVTRFYDINQGEILLDGVNVQDYTLSNLRT HCSVVSQQVHLFNDTIANNIAYAAKDKYSREQIIAAAKAAHAMEFIEPLENGLDTVIGEN GASLSGGQRQRLAIARALLRDSPVLILDEATSALDTESERAIQAALEELQKDRTVLVIAH RLSTIEKADEILVIDHGEICERGSHEELLALNGAYKQLHKMQFNG
Uniprot No.

Target Background

Function

This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.

Database Links

KEGG: msu:MS0932

STRING: 221988.MS0932

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant production of M. succiniciproducens MsbA?

For optimal expression of recombinant M. succiniciproducens MsbA, researchers should consider several expression systems based on the protein's membrane-associated nature:

  • E. coli-based expression systems: Using strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)) with careful temperature control (typically 18-25°C post-induction) to minimize inclusion body formation.

  • Vector selection: Vectors containing mild promoters (like pBAD) or tunable expression systems help control expression rates, which is critical for proper membrane insertion.

  • Fusion tags: N-terminal fusions with MBP (maltose-binding protein) or C-terminal His-tags can improve solubility and facilitate purification while maintaining function.

  • Induction protocol: A gradual induction approach using lower concentrations of inducer (0.1-0.5 mM IPTG if using T7-based systems) and longer expression times (16-24 hours) at lower temperatures.

When establishing an expression protocol, researchers should monitor protein quality through functional assays, as high yield does not always correlate with properly folded, functional protein. Western blotting with anti-His antibodies (if His-tagged) can verify full-length expression, while ATPase activity assays can confirm functionality.

What are the most effective methods for purifying functionally active M. succiniciproducens MsbA?

Purification of functional M. succiniciproducens MsbA requires careful handling to maintain the protein's native conformation:

  • Membrane isolation: After cell lysis (typically via French press or sonication), differential centrifugation isolates the membrane fraction (30,000-100,000g for 1-2 hours).

  • Solubilization: Gentle detergents like n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin at concentrations just above their critical micelle concentration (CMC) effectively extract MsbA while preserving function.

  • Purification steps:

    • Initial capture: IMAC (immobilized metal affinity chromatography) if His-tagged

    • Secondary purification: Size exclusion chromatography to separate protein-detergent complexes from aggregates

    • Optional: Ion exchange chromatography for higher purity

  • Buffer composition: Standard buffers include:

    • 20-50 mM Tris or HEPES (pH 7.4-8.0)

    • 100-300 mM NaCl

    • 5-10% glycerol

    • Detergent at 2-3× CMC

    • 1-5 mM DTT or 2-mercaptoethanol

    • Optional stabilizers: cholesteryl hemisuccinate (CHS) or specific lipids

For long-term storage, the purified protein should be maintained at -20°C or -80°C in a buffer containing 50% glycerol to prevent freeze-thaw damage .

How can researchers reliably assess the functional activity of purified M. succiniciproducens MsbA?

Several complementary approaches can verify that purified M. succiniciproducens MsbA maintains its native function:

  • ATPase activity assays:

    • Colorimetric phosphate release assays (malachite green or molybdate-based)

    • Coupled enzyme assays (NADH oxidation via pyruvate kinase and lactate dehydrogenase)

    • Measurement conditions: 37°C, pH 7.4, with 1-5 mM ATP and 5-10 mM MgCl₂

  • Lipid binding and transport assays:

    • Fluorescent lipid A analogs for direct transport measurements

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters

  • Conformational integrity assessment:

    • Circular dichroism (CD) to verify secondary structure content

    • Intrinsic tryptophan fluorescence for tertiary structure analysis

    • Limited proteolysis to probe domain organization

  • Reconstitution-based functional assays:

    • Proteoliposome-based transport assays with fluorescent or radiolabeled substrates

    • Electrochemical measurements in planar lipid bilayers

When interpreting activity data, it's important to include controls such as ATP-binding deficient mutants or known inhibitors of ABC transporters to validate assay specificity.

What structural biology techniques are most informative for studying the conformational dynamics of M. succiniciproducens MsbA?

Understanding the conformational changes during the transport cycle of M. succiniciproducens MsbA requires sophisticated structural biology approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: Captures multiple conformational states, requires less protein, works well with membrane proteins

    • Workflow: Protein purification in amphipols or nanodiscs → grid preparation → data collection → 3D reconstruction → model building

    • Resolution potential: 2.5-4Å for membrane transporters of this size

  • X-ray crystallography:

    • Challenges: Crystallization of membrane proteins requires specialized techniques (lipidic cubic phase, bicelles)

    • Key additives: Antibody fragments, conformation-specific nanobodies, or designed ankyrin repeat proteins (DARPins) to stabilize specific states

    • Resolution potential: 2-3Å when successful

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility changes during conformational cycling

    • Can identify regions involved in substrate binding and conformational transitions

    • Provides complementary dynamic information to static structural techniques

  • Double electron-electron resonance (DEER) spectroscopy:

    • Requires site-directed spin labeling of paired residues

    • Measures distance changes between domains during ATP binding/hydrolysis cycles

    • Particularly useful for studying NBD-TMD communication

  • Single-molecule Förster resonance energy transfer (smFRET):

    • Monitors real-time conformational changes in individual protein molecules

    • Can identify rare or transient conformational states missed by ensemble techniques

    • Requires site-specific fluorophore labeling at key positions

These methods can be combined to develop a comprehensive model of the conformational cycle of MsbA during lipid A transport.

How can researchers investigate the substrate specificity of M. succiniciproducens MsbA?

Determining the substrate specificity of M. succiniciproducens MsbA involves several complementary approaches:

  • Competition binding assays:

    • Using a known fluorescent substrate as reporter

    • Testing various lipid species and analogs for competition

    • Quantifying IC₅₀ values to rank binding affinities

  • Direct binding measurements:

    • Microscale thermophoresis (MST) with fluorescently labeled protein

    • Surface plasmon resonance (SPR) with immobilized protein

    • Isothermal titration calorimetry (ITC) for label-free thermodynamic parameters

  • Transport assays in reconstituted systems:

    • Inside-out vesicles with radiolabeled or fluorescent lipid substrates

    • Nanodiscs with embedded MsbA for controlled lipid environments

    • Monitoring substrate accumulation or fluorescence changes

  • Molecular dynamics simulations:

    • Predicting binding modes and free energy calculations

    • Identifying key residues involved in substrate recognition

    • Generating hypotheses for mutagenesis studies

  • Site-directed mutagenesis:

    • Systematic mutation of predicted binding pocket residues

    • Functional testing of mutants for altered substrate specificity

    • Correlation of experimental results with structural models

A systematic application of these techniques allows for comprehensive characterization of substrate specificity and the molecular basis for substrate recognition.

What approaches can be used to identify potential inhibitors of M. succiniciproducens MsbA for research applications?

Several screening and rational design strategies can identify inhibitors of M. succiniciproducens MsbA:

  • High-throughput screening methods:

    • ATP hydrolysis inhibition assays in 384-well format

    • Fluorescence-based transport assays with quenching substrates

    • Thermal shift assays to identify compounds that alter protein stability

  • Structure-based virtual screening:

    • Homology modeling based on related ABC transporter structures

    • Molecular docking of compound libraries to predicted binding sites

    • Pharmacophore-based screening focused on ATP-binding pocket or substrate-binding regions

  • Fragment-based drug discovery:

    • NMR-based fragment screening with ¹⁵N-labeled protein

    • Surface plasmon resonance (SPR) to identify weak but efficient binders

    • X-ray crystallography to determine binding modes of fragment hits

  • Design of nucleotide analogs:

    • Non-hydrolyzable ATP analogs (AMP-PNP, ATP-γ-S)

    • Modified adenosine derivatives with altered ribose or base structures

    • Transition state mimics of ATP hydrolysis

  • Validation methods for hit compounds:

    • Dose-response curves for primary hits

    • Mechanism of inhibition studies (competitive vs. non-competitive)

    • Assessment of specificity against related ABC transporters

    • Cellular activity in bacterial growth or lipid transport assays

Table 2: Common Screening Parameters for MsbA Inhibitor Discovery

Screening MethodSample RequirementThroughputHit RateAdvantages
ATP hydrolysis assay0.1-1 μg/well10,000-100,000 cpds/day0.1-0.5%Direct measure of function
Thermal shift1-5 μg/well1,000-5,000 cpds/day1-3%Label-free, stability indication
Virtual screeningStructural model100,000-1,000,000 cpds1-5%No protein needed initially
Fragment screening10-100 mg protein500-2,000 fragments3-10%Efficient chemical space sampling

How can researchers overcome protein instability issues when working with purified M. succiniciproducens MsbA?

Membrane proteins like M. succiniciproducens MsbA are notoriously unstable once removed from their native lipid environment. Several strategies can enhance stability:

  • Optimization of detergent conditions:

    • Screening detergent types: LMNG, GDN, and UDM often provide better stability than DDM

    • Mixed micelles: Combining primary detergent with cholesteryl hemisuccinate (CHS) or specific lipids

    • Detergent concentration: Maintaining sufficient detergent (2-3× CMC) throughout purification

  • Buffer optimization:

    • pH screening (typically 7.0-8.5)

    • Salt type and concentration (150-500 mM NaCl or KCl)

    • Addition of stabilizing agents: glycerol (10-20%), specific lipids (0.01-0.1 mg/ml), or osmolytes (trehalose, sucrose)

  • Alternative solubilization systems:

    • Nanodiscs with MSP proteins and defined lipid composition

    • Amphipols (A8-35 or PMAL-C8) for detergent-free environments

    • Styrene-maleic acid lipid particles (SMALPs) for native lipid environment retention

  • Protein engineering approaches:

    • Removal of flexible termini that may promote aggregation

    • Introduction of disulfide bonds to stabilize conformation

    • Fusion to stabilizing partners (T4 lysozyme, rubredoxin, or thermostabilized proteins)

  • Storage conditions:

    • Flash freezing in liquid nitrogen with 20-50% glycerol

    • Addition of ATP/ADP and Mg²⁺ during storage

    • Storage at higher protein concentrations (>1 mg/ml) to prevent dissociation

Monitoring stability via size-exclusion chromatography, dynamic light scattering, or activity assays at regular intervals can help identify optimal conditions for long-term stability.

What strategies help overcome expression challenges for membrane proteins like M. succiniciproducens MsbA?

Expression of integral membrane proteins like MsbA often results in low yields of functional protein. Researchers can implement several strategies to improve outcomes:

  • Codon optimization:

    • Adapting codons to the expression host (E. coli, yeast, insect cells)

    • Removing rare codons, especially in critical regions

    • Optimizing GC content and removing potential secondary structures in mRNA

  • Expression vector modifications:

    • Using dual promoter systems for coordinated expression of chaperones

    • Including translation enhancers (Shine-Dalgarno sequences, leader sequences)

    • Incorporating transcription terminators to prevent readthrough

  • Host strain selection and modification:

    • C41(DE3)/C43(DE3) strains for toxic membrane proteins

    • Strains overexpressing membrane insertion machinery components

    • Knockout strains missing proteases that degrade overexpressed proteins

  • Chaperone co-expression:

    • General chaperones: GroEL/ES, DnaK/J

    • Specialized membrane protein chaperones: YidC, FtsH

    • Periplasmic chaperones for proper folding after membrane insertion

  • Induction and growth optimization:

    • Auto-induction media for gradual protein expression

    • Biphasic growth: initial biomass accumulation at 37°C followed by expression at 16-20°C

    • Extended expression times (24-72 hours) at lower temperatures

  • Fusion partners for enhanced expression:

    • N-terminal partners: MBP, GST, SUMO, Mistic

    • C-terminal stability tags: GFP to monitor folding and expression levels

    • Cleavable linkers for post-purification tag removal

Implementing these strategies in a systematic manner, often using design of experiments (DoE) approaches, can significantly improve the yield of functional M. succiniciproducens MsbA.

How can researchers troubleshoot inconsistent results in MsbA functional assays?

Functional assays for ABC transporters like MsbA can be technically challenging. Common issues and their solutions include:

  • Variability in ATPase activity measurements:

    • Problem: Background phosphate contamination

    • Solution: Extensive dialysis of reagents, use of phosphate-free buffers, and phosphate scavengers

    • Problem: Inconsistent baseline activity

    • Solution: Include detergent-solubilized lipids (0.01-0.05 mg/ml) to stabilize native conformation

  • Low signal-to-noise ratio in transport assays:

    • Problem: Leaky proteoliposomes

    • Solution: Optimize proteoliposome preparation (lipid composition, protein-to-lipid ratio)

    • Problem: High background binding of hydrophobic substrates

    • Solution: Use rapid filtration techniques, optimize washing steps, include competitors for non-specific binding

  • Inconsistent protein activity between batches:

    • Problem: Variable protein conformation

    • Solution: Verify protein quality by thermal stability assays before functional testing

    • Problem: Inactive protein fraction

    • Solution: Include ATP pre-incubation step to ensure homogeneous conformational population

  • Technical considerations for reproducibility:

    • Standardize protein concentration determination methods

    • Verify detergent concentration is constant between samples

    • Prepare all reagents fresh and allow temperature equilibration

    • Include internal controls and standards in each assay plate

  • Data analysis improvements:

    • Use non-linear regression for enzyme kinetics rather than linear transformations

    • Apply appropriate statistical tests for replicate consistency

    • Develop quality control metrics for assay performance

Table 3: Troubleshooting Guide for Common MsbA Functional Assay Issues

IssuePossible CausesDiagnostic TestSolution
No ATPase activityInactive proteinSEC profile checkOptimize purification, add lipids
ATP degradationATP stability testPrepare fresh ATP, add EDTA
High background in transportLeaky vesiclesCalcein leakage testOptimize lipid composition
Non-specific bindingBinding to empty vesiclesAdd BSA or competitor
Activity loss over timeProtein aggregationDLS analysisAdd stabilizers, lower temperature
Detergent depletionCMC verificationEnsure detergent above CMC

Implementing a systematic approach to assay development and validation can significantly improve reproducibility in MsbA functional studies.

How can M. succiniciproducens MsbA be used as a model system for studying bacterial membrane transport mechanisms?

M. succiniciproducens MsbA offers several advantages as a model system for investigating fundamental aspects of membrane transport:

  • Comparative studies with diverse ABC transporters:

    • Structure-function relationships across different bacterial species

    • Evolution of substrate specificity in the ABC transporter family

    • Conservation of ATP hydrolysis coupling mechanisms

  • Membrane biophysics investigations:

    • Lipid-protein interactions in different membrane environments

    • Effects of membrane composition on transport activity

    • Mechanisms of flipping large amphipathic substrates across membranes

  • Drug resistance mechanism studies:

    • Relationship between MsbA function and antibiotic resistance

    • Structural basis for multi-drug recognition by ABC transporters

    • Development of strategies to overcome transport-mediated resistance

  • Protein dynamics and allostery research:

    • Communication between nucleotide-binding and transmembrane domains

    • Conformational changes during the transport cycle

    • Energetics of substrate binding and release

  • Synthetic biology applications:

    • Engineering altered substrate specificity

    • Development of biosensors based on transport activity

    • Creating chimeric transporters with novel functions

Research with M. succiniciproducens MsbA contributes to our broader understanding of membrane transport mechanisms and can inform both fundamental science and applied biotechnology applications.

What are the current knowledge gaps and future research directions regarding M. succiniciproducens MsbA?

Despite advances in understanding ABC transporters, several knowledge gaps remain regarding M. succiniciproducens MsbA:

  • Structural characterization:

    • High-resolution structures in multiple conformational states

    • Substrate-bound structures to elucidate binding determinants

    • Comparison with homologous MsbA proteins from other species

  • Physiological role in M. succiniciproducens:

    • Impact on membrane lipid composition and asymmetry

    • Contribution to antibiotic resistance

    • Regulation of expression under different growth conditions

  • Substrate specificity determinants:

    • Molecular basis for lipid recognition

    • Potential for transport of non-native substrates

    • Comparative analysis with MsbA from pathogenic bacteria

  • Energy coupling mechanisms:

    • Stoichiometry of ATP hydrolysis to substrate transport

    • Role of proton gradient in transport efficiency

    • Conformational changes during the reaction cycle

  • Potential for biotechnological applications:

    • Engineering for modified substrate specificity

    • Development as a target for novel antibacterial compounds

    • Use in membrane protein expression and purification technologies

Future research directions should focus on integrating structural, biochemical, and computational approaches to develop a comprehensive understanding of M. succiniciproducens MsbA function at the molecular level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.