Recombinant Mannheimia succiniciproducens Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; MS1567; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Mannheimia succiniciproducens (strain MBEL55E)
Target Names
mtgA
Target Protein Sequence
MRLKTLKFPFVNKKNTRTFKKKCGRFLSYFIGLTVALTFLFRFVPIPFSAYMAEQKLAHI IQLDFDYKVNYDWISLEDISPYMQLAVIAAEDQNFPNHGGFDWNAIKSAIKYNEKSSRIR GASTISQQTAKNMFLWHGQSWIRKGIEVPVTFMLETLWSKKRILEVYLNIAEFGNGIFGV EAASRYYFKKPAKRLTQSEAALLAAVLPNPIIYKANRPSLLVRKKQAWIIRQMNSLGLNY LKKL
Uniprot No.

Target Background

Function

Recombinant Mannheimia succiniciproducens Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA): A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links

KEGG: msu:MS1567

STRING: 221988.MS1567

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of mtgA in Mannheimia succiniciproducens cell wall biosynthesis?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) catalyzes the polymerization of lipid II to form glycan strands during peptidoglycan synthesis in M. succiniciproducens. This enzyme performs the critical glycosyltransferase reaction without the transpeptidase activity found in bifunctional penicillin-binding proteins. In the context of M. succiniciproducens, which is known for efficient succinic acid production, proper cell wall synthesis is essential for maintaining cellular integrity during fermentation processes. The enzyme's activity directly affects cell growth kinetics and potentially influences the strain's robustness under various fermentation conditions.

What expression systems are most effective for producing recombinant M. succiniciproducens mtgA?

For laboratory-scale expression of M. succiniciproducens mtgA, E. coli-based expression systems have proven effective for similar bacterial transglycosylases. When expressing membrane-associated enzymes like mtgA, researchers should consider the following optimization parameters:

Expression ParameterRecommended ConditionsRationale
Host strainE. coli BL21(DE3) or C41(DE3)Better tolerance for membrane protein expression
Induction temperature16-25°CReduces inclusion body formation
Inducer concentration0.1-0.5 mM IPTGBalances expression level and protein solubility
Media supplements0.5-1% glucoseReduces basal expression before induction
Extraction bufferDetergent-containing (0.1-1% DDM or CHAPS)Facilitates membrane protein solubilization

Similar expression strategies have been successfully employed for other M. succiniciproducens enzymes, such as malate dehydrogenase (MDH), which has been expressed for enhanced succinic acid production .

How can activity assays for recombinant M. succiniciproducens mtgA be optimized for kinetic characterization?

Kinetic characterization of M. succiniciproducens mtgA requires careful optimization of transglycosylase activity assays. Researchers typically employ one of three methodological approaches:

  • Fluorescent lipid II substrate assay: This approach utilizes dansylated or fluorescently labeled lipid II substrate, allowing for real-time monitoring of transglycosylase activity. The reaction conditions should be optimized based on the following parameters:

ParameterRecommended RangeOptimization Notes
Buffer pH7.5-8.5Test at 0.2 pH intervals to determine optimal pH
Divalent cations5-15 mM Mg²⁺ or Mn²⁺Essential for enzyme activity
Substrate concentration5-50 μM lipid IIFor determining Km and Vmax
Temperature25-37°CM. succiniciproducens optimal growth at 37°C
Detergent0.01-0.05% Triton X-100Facilitates substrate accessibility
  • HPLC-based muropeptide analysis: This method allows quantitative assessment of the glycan chain length distribution resulting from transglycosylase activity, providing insights into the enzyme's processivity.

  • Coupled enzyme assays: Similar to the approach used for measuring phosphotransferase system activity in M. succiniciproducens (3.70 ± 0.15 mU mg protein⁻¹ in wild-type strain cultured in MH5S medium) , coupled assays can be developed to measure mtgA activity indirectly.

What is the impact of recombinant mtgA overexpression on M. succiniciproducens cell morphology and succinic acid production?

Overexpression of cell wall biosynthetic enzymes like mtgA can significantly impact bacterial cell morphology and potentially affect metabolic performance. For M. succiniciproducens, which has been extensively engineered for enhanced succinic acid production, the relationship between cell wall integrity and metabolic output merits investigation.

Preliminary observations suggest that balanced expression of cell wall enzymes may contribute to improved cell robustness during high-density fermentations. Similar to findings with MDH optimization, where expression of Corynebacterium glutamicum MDH (CgMDH) in M. succiniciproducens PALK strain produced 87.23 g L⁻¹ of succinic acid with yield and productivity of 1.29 mol mol⁻¹ glucose and 3.6 g L⁻¹ h⁻¹ respectively , the optimization of mtgA expression could potentially enhance cellular integrity during fermentation.

Researchers investigating this aspect should conduct comparative studies examining:

  • Cell morphology changes via electron microscopy

  • Growth kinetics under various fermentation conditions

  • Succinic acid production titers and productivity

  • Cell lysis rates during extended fermentation periods

How do site-directed mutations in the catalytic domain of M. succiniciproducens mtgA affect its enzymatic properties?

Structure-function relationships in transglycosylases can be probed through site-directed mutagenesis of conserved catalytic residues. For M. succiniciproducens mtgA, researchers should consider the following experimental approach:

  • Target residue identification: Based on sequence alignment with characterized transglycosylases, identify the conserved catalytic glutamate and other structurally important residues.

  • Mutagenesis strategy: Design a panel of mutations including:

    • Conservative substitutions (e.g., Glu→Asp)

    • Non-conservative substitutions (e.g., Glu→Gln or Ala)

    • Mutations in secondary substrate-binding sites

  • Kinetic parameter determination: Compare wild-type and mutant enzymes for:

This approach is similar to the structural comparison performed between MDH variants of M. succiniciproducens (MsMDH) and C. glutamicum (CgMDH), where a key residue (Gly11 in MsMDH versus Gln20 in CgMDH) was identified as influencing specific activity and susceptibility to substrate inhibition .

What purification protocol yields the highest specific activity for recombinant M. succiniciproducens mtgA?

Purification of membrane-associated enzymes like mtgA presents significant challenges. A systematic purification strategy for recombinant M. succiniciproducens mtgA should include:

  • Initial extraction optimization:

DetergentConcentration RangeAdvantages/Disadvantages
n-Dodecyl-β-D-maltoside (DDM)0.5-2%Mild, preserves activity, expensive
Triton X-1000.5-2%Cost-effective, may affect activity
CHAPS0.5-3%Good for crystallography, variable yield
  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged protein

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography for final polishing

  • Activity preservation:

    • Include 10-20% glycerol in all buffers

    • Maintain detergent above critical micelle concentration

    • Add reducing agents (0.5-1 mM DTT or 2-5 mM β-mercaptoethanol)

The purification protocol should be validated by specific activity measurements at each step, with a target of achieving at least 80% purity with retained enzymatic activity.

How can isothermal titration calorimetry (ITC) be adapted to study substrate binding by M. succiniciproducens mtgA?

ITC provides valuable thermodynamic information about enzyme-substrate interactions. For membrane proteins like mtgA, standard ITC protocols require modification:

  • Sample preparation considerations:

    • Protein must be in detergent micelles at consistent concentration

    • Lipid II substrate solubilized in matching detergent system

    • Buffer matching critically important to minimize dilution heat

  • Experimental parameters:

    • Lower protein concentrations (1-5 μM) than typical ITC experiments

    • Higher substrate concentrations (50-500 μM) to achieve saturation

    • Extended equilibration times between injections (180-300 seconds)

  • Data analysis adjustments:

    • Account for detergent micelle effects on apparent binding constants

    • Consider cooperative binding models if glycan strand formation occurs

    • Use control experiments with catalytically inactive mutants

Similar biophysical approaches have been valuable in characterizing other M. succiniciproducens enzymes, such as the structural comparison of MDH variants that revealed differences in substrate inhibition (ki of 67.4 and 588.9 μM for MsMDH and CgMDH, respectively) .

What are the optimal conditions for crystallizing recombinant M. succiniciproducens mtgA for structural determination?

Crystallization of membrane-associated proteins like mtgA requires specialized approaches:

  • Pre-crystallization considerations:

    • Detergent screening (DDM, LDAO, OG, CYMAL series)

    • Lipid cubic phase methods versus detergent-based approaches

    • Addition of stabilizing ligands (substrate analogs, inhibitors)

  • Initial screening parameters:

ParameterRecommended ApproachRationale
Temperature4°C and 18°C parallel screensLower temperatures often beneficial for membrane proteins
Protein concentration5-15 mg/mLConcentration range effective for similar enzymes
AdditivesPEG 400, glycerol, MPDHelps stabilize membrane proteins
PrecipitantsPEG series (2000-8000)Commonly successful with membrane proteins
pH range6.0-8.5Covers physiological range for enzyme
  • Optimization strategies:

    • Microseeding from initial crystals

    • Lipid sponge phase for membrane protein crystals

    • Surface entropy reduction mutations if initial crystals are inadequate

Researchers should consider fragment-based approaches if full-length protein crystallization proves challenging, focusing on the catalytic domain without membrane-associated regions.

How does mtgA activity coordinate with central carbon metabolism in M. succiniciproducens during succinic acid production?

The relationship between cell wall biosynthesis and central carbon metabolism in M. succiniciproducens represents an important but understudied aspect of cellular physiology. The major metabolic pathways for succinic acid production in M. succiniciproducens involve the reductive branch of the tricarboxylic acid (TCA) cycle, with key enzymes including phosphoenolpyruvate carboxykinase (PCKA), malate dehydrogenase (MDH), fumarase (FUMC), and fumarate reductase (FRD) .

The connection between mtgA and these pathways may be investigated through:

  • Metabolic flux analysis comparing wild-type and mtgA-overexpressing strains to determine if peptidoglycan precursor synthesis diverts carbon from succinic acid production

  • Gene expression correlation studies examining whether mtgA expression is coordinated with central metabolic enzymes under different growth conditions

  • Metabolomics profiling to identify potential bottlenecks or accumulation of intermediates when mtgA expression is altered

Similar to how enhanced MDH activity improved succinic acid production in M. succiniciproducens PALK strain , understanding the interplay between cell wall synthesis and central metabolism could reveal new engineering targets.

What techniques are most effective for engineering M. succiniciproducens mtgA to enhance cell integrity during high-density fermentation?

Engineering mtgA for improved cell integrity during industrial fermentation represents an advanced application of enzyme engineering. Researchers should consider:

  • Directed evolution approaches:

    • Error-prone PCR libraries of mtgA

    • Selection under high osmotic stress conditions

    • Screening for improved growth at high cell densities

  • Rational design strategies:

    • Engineering substrate specificity through active site modifications

    • Altering enzyme processivity to modify glycan chain length

    • Enhancing protein stability for improved performance during long fermentations

  • Expression regulation approaches:

    • Designing inducible or growth-phase dependent promoters

    • Balancing mtgA expression with other cell wall enzymes

    • Heterologous expression of mtgA variants from related organisms

The benefits of enzyme engineering have been demonstrated with MDH in M. succiniciproducens, where replacing native MsMDH with CgMDH resulted in a 1.5-fold higher specific activity in cell extracts, contributing to enhanced succinic acid production .

How can advanced microscopy techniques be applied to study the localization and dynamics of mtgA in M. succiniciproducens?

Understanding the subcellular localization and dynamics of mtgA requires sophisticated microscopy approaches:

  • Fluorescent protein fusions:

    • C-terminal versus N-terminal GFP fusions (considering functional constraints)

    • mCherry or other pH-stable fluorophores for use during acid production

    • Verification that fusion proteins retain catalytic activity

  • Super-resolution techniques:

    • Structured illumination microscopy (SIM) for improved resolution

    • Stochastic optical reconstruction microscopy (STORM) for nanoscale localization

    • Single-particle tracking for dynamics studies

  • Correlative approaches:

    • Combining fluorescence with electron microscopy to relate protein localization to ultrastructural features

    • Time-lapse imaging during different growth phases and fermentation conditions

These approaches would provide insights into whether mtgA localizes to specific regions during cell growth and division, similar to the spatiotemporal patterns observed for peptidoglycan synthesis enzymes in model organisms.

What is the most effective method to quantify changes in peptidoglycan structure resulting from altered mtgA activity in M. succiniciproducens?

Quantitative analysis of peptidoglycan structural changes requires specialized analytical techniques:

  • HPLC-MS analysis of muropeptides:

    • Enzymatic digestion of peptidoglycan with mutanolysin

    • Separation of muropeptides by reverse-phase HPLC

    • Identification and quantification by mass spectrometry

    Expected parameters to measure include:

Peptidoglycan ParameterWild-type (hypothetical)mtgA OverexpressionmtgA Deletion/Reduction
Average glycan chain length25-35 disaccharide unitsIncreasedDecreased
Cross-linking degree40-50%VariableVariable
Anhydromuropeptide content3-5%DecreasedIncreased
Glycan chain length distributionNormal distributionShifted to longer chainsShifted to shorter chains
  • Solid-state NMR spectroscopy:

    • Analysis of intact peptidoglycan without chemical modification

    • Measurement of local rigidity and dynamics

    • Detection of subtle structural changes not apparent in muropeptide analysis

  • Atomic force microscopy:

    • Direct visualization of purified sacculi

    • Measurement of mechanical properties (stiffness, elasticity)

    • Correlation of molecular changes with physical properties

These analytical approaches would provide comprehensive data on how mtgA activity influences peptidoglycan architecture and potentially affects cell resistance to osmotic stress during fermentation.

How does mtgA expression integrate into the regulatory networks governing cell wall synthesis and stress response in M. succiniciproducens?

Understanding the regulatory context of mtgA expression requires systems biology approaches:

  • Transcriptomic analysis across various growth conditions and stress exposures to identify co-regulated genes and potential regulatory factors

  • Promoter analysis to identify binding sites for known transcription factors involved in cell wall homeostasis and stress responses

  • Regulatory network reconstruction integrating:

    • ChIP-seq data for key transcription factors

    • RNA-seq data under various conditions

    • Protein-protein interaction mapping

Similar strategies have been applied to understand the regulation of metabolic pathways in M. succiniciproducens for enhanced succinic acid production , and extending these approaches to cell wall biosynthesis would provide valuable insights for strain engineering.

What computational models best predict the impact of mtgA modifications on M. succiniciproducens cell wall integrity and fermentation performance?

Predictive modeling of the relationship between mtgA activity, cell wall integrity, and fermentation performance would integrate multiple computational approaches:

  • Molecular dynamics simulations of mtgA and its interaction with peptidoglycan precursors

  • Genome-scale metabolic models incorporating cell wall biosynthesis pathways

  • Machine learning approaches trained on experimental datasets linking enzyme variants to fermentation outcomes

These integrated models could be used to guide rational engineering strategies, similar to how in silico genome-scale metabolic analyses were performed to enhance succinic acid production in M. succiniciproducens through energy balance optimization, byproduct pathway elimination, and flux re-routing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.