Recombinant Mannheimia succiniciproducens Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Na(+)-translocating NADH-quinone reductase subunit E (nqrE) is a component of the Na(+)-translocating NADH-quinone oxidoreductase (Na(+)-NQR) complex, which catalyzes the transfer of electrons from NADH to quinone, coupled with sodium ion translocation across the membrane. This process is vital for maintaining electrochemical gradients essential for ATP synthesis and secondary transport systems .

Functional Domains:

  • Transmembrane helices: Predicted to anchor the protein within the cytoplasmic membrane.

  • NADH-binding motifs: Critical for interaction with NADH during electron transfer.

  • Sodium ion coordination sites: Implicated in ion translocation.

Enzymatic Role in Metabolism

The Na(+)-NQR complex, including nqrE, is integral to M. succiniciproducens’s anaerobic respiration:

  1. Electron Transfer: Oxidizes NADH, transferring electrons to quinone.

  2. Sodium Translocation: Generates a sodium gradient used for ATP synthesis and nutrient transport.

  3. Energy Conservation: Supports succinic acid production by maintaining redox balance .

Biotechnological Relevance

Recombinant nqrE holds potential for:

  • Enzyme Engineering: Optimizing electron transport efficiency to enhance succinic acid titers.

  • Synthetic Biology: Designing energy-efficient pathways in industrial microbial strains.

Data Gaps and Future Directions

Current knowledge gaps include:

  • Structural Resolution: No crystal structure of nqrE is available.

  • Kinetic Studies: Detailed characterization of substrate affinity and inhibition profiles.

  • In Vivo Functional Analysis: Knockout studies to quantify its metabolic impact.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; MS0305; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Mannheimia succiniciproducens (strain MBEL55E)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGISVPVNQLVY THILKDGALIEGVDLSFLNFITFIGVIAALVQILEMFLDKFVPSLYEALGIFLPLITVNC AIFGGVSFMVQREYNFPESVVYGIGAGTGWMLAIVALAGLTEKMKYADVPAGLRGLGITF ITVGLMALGFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: msu:MS0305

STRING: 221988.MS0305

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Mannheimia succiniciproducens Na(+)-translocating NADH-quinone reductase and what role does subunit E (nqrE) play in the complex?

The Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) is a membrane-bound respiratory complex that catalyzes the oxidation of NADH and the reduction of quinone while simultaneously pumping sodium ions across the bacterial membrane. This enzyme serves as the main entry site for electrons into the respiratory chain of many marine and pathogenic bacteria . In Mannheimia succiniciproducens, this enzyme complex plays a crucial role in energy metabolism, particularly under anaerobic conditions.

The nqrE subunit is one of six subunits (NqrA-F) that comprise the Na+-NQR complex. Based on structural and functional studies of homologous enzymes in bacteria like Vibrio cholerae, nqrE is likely a transmembrane protein that contributes to the formation of the sodium translocation pathway. The subunit is thought to participate in the coupling mechanism between electron transfer and sodium ion transport, though its exact role in M. succiniciproducens requires further characterization.

How do the redox cofactors in Na+-NQR contribute to electron transfer and sodium pumping?

The Na+-NQR complex contains multiple redox cofactors that participate in a step-wise electron transfer chain. Based on studies with the V. cholerae enzyme, these include:

  • FAD - Bound to the NqrF subunit, serving as the initial electron acceptor from NADH

  • 2Fe-2S center - Located in NqrF, receives electrons from FAD

  • FMN cofactors (designated as FMN B and FMN C) - Located in different subunits

  • Riboflavin - Forms a neutral semiquinone (RibH- ) that appears to be crucial for sodium ion translocation

The electron transfer pathway follows:
NADH → FAD → 2Fe-2S → FMN C → FMN B → Riboflavin → Quinone

Experiments with V. cholerae Na+-NQR have demonstrated that specific redox steps are associated with sodium ion binding and ejection. The reduction of FMN C appears to be associated with sodium binding, while the reduction of riboflavin (specifically the formation of the neutral semiquinone) is associated with sodium ejection . This redox-coupled mechanism is essential for the energy transduction function of the enzyme.

What experimental approaches are typically used to study recombinant Na+-NQR subunits?

Several experimental approaches are commonly employed to study recombinant Na+-NQR subunits:

  • Heterologous expression systems: E. coli expression systems are frequently used for producing recombinant subunits, with appropriate modifications to expression vectors to enhance membrane protein production.

  • Purification techniques: Affinity chromatography (using His-tags) followed by size exclusion chromatography is commonly employed to purify recombinant subunits.

  • Spectroscopic analysis: UV-visible spectroscopy and EPR (Electron Paramagnetic Resonance) are used to characterize the flavin cofactors and iron-sulfur centers. EPR is particularly valuable for detecting semiquinone radicals, as demonstrated in studies with V. cholerae enzyme .

  • Functional assays: NADH:quinone oxidoreductase activity can be measured spectrophotometrically by monitoring NADH oxidation. Alternative electron acceptors like menadione can be used to assess electron transfer through specific segments of the pathway .

  • Membrane potential measurements: Techniques to measure sodium-dependent membrane potential generation (ΔΨ) are crucial for evaluating the sodium pumping activity of reconstituted complexes .

What are the key experimental design considerations for studying the redox-coupled sodium transport mechanism in recombinant nqrE?

When investigating the redox-coupled sodium transport mechanism involving nqrE, researchers should consider:

  • Selection of appropriate experimental system:

    • Purified recombinant protein vs. membrane vesicles vs. whole cells

    • Reconstitution into proteoliposomes for transport studies

  • Control of experimental variables:

    • pH and ionic strength affect flavin redox potentials

    • Temperature impacts both electron transfer rates and membrane fluidity

    • Quinone substrate selection influences electron transfer rates

  • Measurement techniques:

    • Stopped-flow spectroscopy for rapid kinetic analysis of redox transitions

    • Simultaneous monitoring of redox states and sodium movement

    • Use of sodium-sensitive fluorescent probes or radioisotopes

  • Experimental design type:

    • True experimental designs with appropriate controls are optimal but challenging with membrane proteins

    • Quasi-experimental designs may be necessary due to technical limitations

  • Inhibitor studies:

    • Using quinol (CoQH₂) as an inhibitor to block specific redox steps

    • Comparison of inhibition patterns under single turnover vs. steady-state conditions

A particularly valuable approach involves stopped-flow kinetic analysis under partial turnover conditions, which can resolve the individual electron transfer steps and correlate them with sodium transport events. This technique has successfully identified the riboflavin reduction step as critical for sodium ejection in V. cholerae Na+-NQR .

How can site-directed mutagenesis be used to identify critical residues in nqrE involved in sodium translocation?

Site-directed mutagenesis is a powerful approach for identifying critical residues involved in sodium translocation. Based on studies with homologous Na+-NQR complexes, researchers should consider:

  • Target selection strategy:

    • Conserved charged residues (Asp, Glu) potentially forming the sodium channel

    • Polar residues (Ser, Thr) that may coordinate sodium ions

    • Residues at predicted transmembrane/cytoplasmic interfaces

  • Mutation design principles:

    • Conservative substitutions (e.g., Asp→Asn) to maintain structure while eliminating charge

    • Charge reversal mutations (e.g., Asp→Lys) to test electrostatic interactions

    • Introduction of bulky side chains to probe spatial constraints

  • Functional analysis of mutants:

    • Enzyme activity assays with varying sodium concentrations to determine Km^Na values

    • Sodium-dependent ΔΨ formation to assess transport efficiency

    • Redox kinetics to identify altered electron transfer steps

  • Comparative analysis framework:

    • Analysis against known mutations in homologous systems (e.g., NqrB-D346A mutant in V. cholerae)

    • Correlation of phenotypes with structural predictions

Mutation TypeExpected Effect on Sodium BindingExpected Effect on TransportAnalysis Methods
D→N (neutralization)Reduced affinityReduced transport rateKm^Na determination, ΔΨ formation
D→E (conserved charge)Minimal effect on bindingPotential alteration of transport kineticsStopped-flow kinetics
D→K (charge reversal)Abolished bindingBlocked transportEPR spectroscopy, redox kinetics
T→Y (bulky substitution)Steric hindrance of binding siteBlocked transportComparison to NqrB-T236Y

Studies with V. cholerae Na+-NQR have demonstrated that specific mutations (such as NqrB-D346A) can significantly alter the redox properties of the enzyme, blocking electron transfer between flavin cofactors and preventing sodium ejection . Similar approaches can be applied to nqrE from M. succiniciproducens to identify residues critical for sodium translocation.

What are the methodological approaches for resolving the thermodynamics and kinetics of electron transfer through the Na+-NQR complex?

Resolving the thermodynamics and kinetics of electron transfer requires sophisticated methodological approaches:

  • Thermodynamic characterization:

    • Potentiometric titrations to determine midpoint potentials of cofactors

    • Spectroelectrochemical techniques for component-specific redox potential determination

    • Temperature-dependent studies to determine entropic contributions

  • Kinetic analysis:

    • Stopped-flow spectroscopy for millisecond time resolution

    • Laser flash photolysis for microsecond events

    • Freeze-quench EPR for capturing transient intermediates

  • Experimental design considerations:

    • Single electron injection vs. multiple turnover conditions

    • Isolation of specific electron transfer steps using partial reactions

    • Use of alternative electron donors/acceptors to bypass specific segments

  • Data analysis frameworks:

    • Application of Marcus theory to correlate rates with driving forces

    • Global fitting of multi-wavelength data to resolve spectral components

    • Kinetic modeling to test mechanistic hypotheses

Studies with V. cholerae Na+-NQR have employed a combination of these approaches, particularly stopped-flow spectroscopy under both single turnover and steady-state conditions, to resolve the electron transfer pathway and its relationship to sodium translocation . The analysis revealed distinct kinetic phases corresponding to reduction of different cofactors, allowing researchers to associate specific redox steps with sodium binding and ejection events.

How do the properties of Na+-NQR from M. succiniciproducens compare with those from other bacterial species, and what implications does this have for experimental design?

While specific data on M. succiniciproducens Na+-NQR is limited in the provided search results, comparative analysis with other bacterial Na+-NQR systems suggests several important considerations:

  • Phylogenetic context:

    • M. succiniciproducens is a gram-negative bacterium like V. cholerae but belongs to a different family

    • The gene organization of the nqr operon may differ, affecting expression strategies

  • Metabolic context:

    • M. succiniciproducens is known for succinate production under anaerobic conditions

    • This suggests its Na+-NQR may have adaptations for function in low-oxygen environments

  • Growth conditions for optimizing expression:

    • If expressing the native enzyme, M. succiniciproducens can be cultured using whey and corn steep liquor (CSL)

    • For heterologous expression, modifications to standard protocols may be necessary

  • Experimental design adjustments:

    • Buffer composition may need to be optimized for M. succiniciproducens enzyme stability

    • Detergent selection for membrane protein solubilization may differ from protocols for V. cholerae

  • Functional characterization:

    • Initial characterization should establish whether the basic mechanism (coupling of specific redox steps to sodium translocation) is conserved

    • Differences in quinone specificity may necessitate adjustment of activity assays

Given the limited specific information available on M. succiniciproducens Na+-NQR, researchers should initially apply techniques proven successful with other bacterial Na+-NQR systems while systematically optimizing conditions for the specific properties of the M. succiniciproducens enzyme.

What strategies can be employed to overcome challenges in expressing and purifying functional recombinant nqrE?

Membrane proteins like nqrE present significant challenges for recombinant expression and purification. The following strategies can help overcome these challenges:

  • Expression system optimization:

    • Testing multiple host strains (E. coli C41/C43, specialized for membrane proteins)

    • Evaluating different promoters (T7, tac, arabinose-inducible)

    • Codon optimization for the expression host

    • Addition of fusion partners (MBP, SUMO) to improve solubility

  • Expression condition optimization:

    • Reduced temperature (16-25°C) to slow folding and insertion into membranes

    • Lower inducer concentrations to prevent overwhelming membrane insertion machinery

    • Addition of specific lipids or membrane-stabilizing agents to culture media

  • Purification strategy development:

    • Screening multiple detergents for optimal solubilization

    • Two-step affinity purification (e.g., His-tag plus additional tag)

    • On-column refolding for inclusion body recovery

    • Size exclusion chromatography as final polishing step

  • Functional assessment methods:

    • Spectroscopic verification of cofactor incorporation

    • Limited proteolysis to assess proper folding

    • Reconstitution into proteoliposomes to test functionality

  • Co-expression strategies:

    • Co-expression with chaperones to assist folding

    • Co-expression of multiple subunits to promote complex assembly

    • Co-expression with enzymes involved in cofactor synthesis

A systematic approach combining these strategies, starting with small-scale expression trials and progressively scaling up successful conditions, offers the best chance of obtaining functional recombinant nqrE for detailed biochemical and biophysical studies.

How can researchers accurately measure and quantify sodium transport by recombinant Na+-NQR components?

Accurate measurement of sodium transport by Na+-NQR components requires specialized techniques:

  • Direct measurement techniques:

    • ²²Na+ radioisotope flux measurements in proteoliposomes

    • Sodium-selective electrodes for real-time monitoring

    • Sodium-sensitive fluorescent probes (e.g., SBFI, CoroNa Green)

  • Indirect measurement techniques:

    • Membrane potential (ΔΨ) measurements using voltage-sensitive dyes

    • pH changes associated with secondary H⁺/Na⁺ exchange

    • Enzyme activity dependence on sodium concentration

  • Experimental design considerations:

    • Establishment of appropriate sodium gradients

    • Control of other ion concentrations (particularly potassium)

    • Use of ionophores and inhibitors as controls

  • Data analysis approaches:

    • Kinetic modeling to distinguish transport from binding

    • Determination of stoichiometry (Na⁺/electron ratio)

    • Correlation of transport rates with specific redox steps

Studies with V. cholerae Na+-NQR have successfully employed measurement of ΔΨ formation under partial turnover conditions to correlate sodium translocation with specific redox steps . This approach, combined with site-directed mutagenesis and inhibitor studies, provides a powerful framework for investigating the molecular mechanisms of sodium transport.

What are the considerations for designing experiments to investigate the effects of environmental factors on nqrE function?

When investigating how environmental factors affect nqrE function, researchers should consider:

  • pH effects:

    • Impact on protein stability and conformation

    • Alteration of flavin redox potentials

    • Changes in protonation state of key residues

    • Experimental design: pH-activity profiles with multiple buffers to control for buffer effects

  • Temperature dependence:

    • Effect on enzyme kinetics (determination of activation energy)

    • Impact on membrane fluidity when studying in membrane environment

    • Protein stability at different temperatures

    • Experimental design: Arrhenius plots, thermal stability assays

  • Ionic strength considerations:

    • Screening of electrostatic interactions

    • Competition between different cations for binding sites

    • Impact on membrane surface potential

    • Experimental design: Activity measurements at varying ionic strengths with controlled sodium concentration

  • Oxygen sensitivity:

    • Protection against oxidative damage to flavin cofactors

    • Maintenance of reduced state of iron-sulfur centers

    • Experimental design: Comparison of anaerobic vs. aerobic preparation methods

  • Experimental design types:

    • True experimental designs with randomized conditions and controls

    • Factorial designs to assess interaction between multiple factors

    • Response surface methodology to optimize multiple parameters simultaneously

For each environmental factor, researchers should implement appropriate control experiments and consider interactions between factors that might yield non-additive effects on enzyme function.

How can structural modeling and computational approaches complement experimental studies of nqrE?

Structural modeling and computational approaches provide valuable complements to experimental studies of nqrE:

  • Homology modeling approaches:

    • Template selection: Using structures of homologous proteins (e.g., Na+-NQR components from V. cholerae)

    • Model validation: Assessment using energy minimization and Ramachandran plots

    • Refinement: Integration of experimental constraints

  • Molecular dynamics simulations:

    • Membrane protein embedding in lipid bilayers

    • Investigation of sodium binding sites and transport pathways

    • Assessment of conformational changes coupled to redox events

    • Calculation of binding free energies for sodium ions

  • Quantum mechanical calculations:

    • Electronic structure of flavin cofactors in different redox states

    • Calculation of redox potentials

    • Modeling of electron transfer reactions

  • Integration with experimental data:

    • Incorporation of distance constraints from crosslinking studies

    • Validation of predicted sodium binding sites by mutagenesis

    • Refinement of models based on spectroscopic data

  • Prediction of functional sites:

    • Identification of conserved residues through multiple sequence alignment

    • Prediction of sodium coordination sites based on geometric criteria

    • Docking of quinone substrates to identify binding sites

These computational approaches can guide experimental design by generating testable hypotheses about structure-function relationships in nqrE, particularly regarding the mechanism of coupling between electron transfer and sodium transport.

How can systems biology approaches be applied to understand the role of Na+-NQR in the broader energy metabolism of M. succiniciproducens?

Systems biology offers powerful frameworks for understanding Na+-NQR in the context of M. succiniciproducens metabolism:

  • Metabolic network analysis:

    • Integration of Na+-NQR activity into genome-scale metabolic models

    • Flux balance analysis to predict impact of Na+-NQR activity on succinate production

    • Identification of metabolic reactions linked to Na+-NQR function

  • Transcriptomic approaches:

    • RNA-Seq analysis to identify co-regulated genes under various conditions

    • Determination of nqr operon expression patterns in response to environmental changes

    • Identification of transcriptional regulators controlling nqr expression

  • Proteomics integration:

    • Quantitative proteomics to measure Na+-NQR subunit stoichiometry in vivo

    • Post-translational modification analysis

    • Protein-protein interaction networks involving Na+-NQR subunits

  • Multi-omics data integration:

    • Correlation of Na+-NQR activity with global metabolic patterns

    • Identification of metabolic bottlenecks affected by Na+-NQR function

    • Prediction of engineering targets to optimize energy metabolism

M. succiniciproducens is known for its ability to produce succinate efficiently using various carbon sources, including whey . Systems biology approaches can help elucidate how Na+-NQR contributes to the energetic efficiency of this process, potentially informing strategies for optimizing bioproduction pathways.

What are the methodological considerations for comparing Na+-NQR function between different bacterial species?

When comparing Na+-NQR function between species, researchers should consider:

  • Standardization of experimental conditions:

    • Unified assay conditions for cross-species comparisons

    • Normalization strategies for activity measurements

    • Consideration of native lipid environments

  • Phylogenetic context:

    • Construction of phylogenetic trees based on nqr operon sequences

    • Correlation of functional differences with evolutionary distance

    • Identification of conserved vs. variable regions

  • Structural comparison approaches:

    • Homology modeling based on available structures

    • Identification of species-specific structural features

    • Analysis of cofactor binding sites conservation

  • Functional parameter comparison:

    • Kinetic parameters (Km, Vmax) for NADH and quinone

    • Na+ affinity and transport rates

    • Inhibitor sensitivity profiles

  • Experimental design considerations:

    • Quasi-experimental designs may be necessary for cross-species comparisons

    • Control of environmental variables to isolate species-specific effects

    • Statistical methods for handling biological variability

Comparative studies between M. succiniciproducens Na+-NQR and well-characterized systems like V. cholerae Na+-NQR can provide insights into adaptations of this enzyme to different ecological niches and metabolic contexts, potentially revealing principles of structure-function relationships applicable across bacterial species.

What are the most promising future directions for research on recombinant M. succiniciproducens nqrE?

Based on current knowledge and technological capabilities, several promising research directions emerge:

  • Structural biology approaches:

    • Cryo-EM analysis of the complete Na+-NQR complex

    • Crystallization trials of individual subunits including nqrE

    • Hybrid approaches combining computational modeling with experimental constraints

  • Advanced biophysical techniques:

    • Single-molecule FRET to monitor conformational changes

    • Solid-state NMR of reconstituted nqrE in membrane environments

    • Time-resolved spectroscopy to capture transient intermediates

  • Systems-level integration:

    • Engineering of reporter systems to monitor Na+-NQR activity in vivo

    • Integration with other respiratory complexes to understand electron flow

    • Metabolic engineering applications leveraging Na+-NQR function

  • Comparative biochemistry:

    • Detailed comparison of M. succiniciproducens Na+-NQR with homologs from diverse bacteria

    • Investigation of species-specific adaptations in sodium pumping mechanisms

    • Evolutionary analysis of Na+-NQR components

These research directions, pursued with rigorous experimental design and appropriate methodological approaches, promise to enhance our understanding of this fascinating enzyme complex and its role in bacterial energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.