Recombinant Mannheimia succiniciproducens Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Lgt and Its Biological Role

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme in bacterial lipoprotein biogenesis, catalyzing the transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine (+1 position) of prolipoproteins. This modification is essential for lipoprotein maturation, membrane anchoring, and bacterial viability . While extensively studied in Escherichia coli and other Gram-negative bacteria, Lgt homologs are also present in Gram-positive bacteria, including Streptococcus suis .

Key Features of Lgt:

FeatureDescription
Enzymatic ActivityTransfers sn-1,2-diacylglyceryl from phosphatidylglycerol to cysteine .
Membrane TopologySeven transmembrane segments in E. coli; N-terminus faces periplasm .
Conserved MotifsSignature motif with invariant residues (e.g., Y26, N146, G154 in E. coli) .
Essential ResiduesY26, N146, G154 (absolutely required); R143, E151, R239, E243 (critical) .

Mannheimia succiniciproducens: Context and Metabolic Relevance

Mannheimia succiniciproducens MBEL55E is a capnophilic Gram-negative bacterium renowned for its high-yield succinic acid production . While its genome-scale metabolic network has been extensively characterized for biotechnological applications , no direct studies on Lgt in M. succiniciproducens were identified in the provided sources.

Metabolic Engineering Focus:

TraitPurpose
Succinic Acid PathwayOptimized via PEP carboxylation, branched TCA cycle, and by-product elimination .
Substrate UtilizationEfficient use of sucrose, lactose, and whey via PTS systems .
Genetic KnockoutsldhA, pflB, pta, ackA deletions to enhance succinic acid yield .

Recombinant Lgt: Challenges and Cross-Species Insights

Comparative Analysis of Lgt Across Species:

SpeciesKey Lgt FeaturesReferences
Escherichia coli7 transmembrane domains; N-terminus periplasmic; signature motif faces periplasm .
Streptococcus suisLipid modification essential for immune activation; Lgt inactivates lipoproteins .
Nitrosospira multiformisRecombinant His-tagged Lgt (1-289 aa) available for biochemical studies .

Hypothetical Applications of Recombinant M. succiniciproducens Lgt

While speculative, recombinant Lgt from M. succiniciproducens could theoretically be explored for:

  1. Antibiotic Development: Targeting Lgt disrupts outer membrane integrity, as shown in E. coli .

  2. Metabolic Engineering: Modulating lipoprotein biosynthesis to enhance succinic acid production or membrane stability.

  3. Structural Biology: Elucidating species-specific variations in Lgt topology or substrate binding.

Research Gaps and Future Directions

  1. Lgt Function in M. succiniciproducens: No studies explicitly address Lgt’s role in this species.

  2. Recombinant Production: No reports on heterologous expression or purification of M. succiniciproducens Lgt.

  3. Comparative Biochemistry: Structural or functional comparisons with E. coli Lgt remain unexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; MS0406; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Mannheimia succiniciproducens (strain MBEL55E)
Target Names
lgt
Target Protein Sequence
MENQFLAFPQFDPIIFSLGPISLRWYGLMYLIGFIFARWLAVKRANRPDSGWTVEQVDNL LFNGFAGVFLGGRIGYVLFYQWDLFVQEPSYLFRVWEGGMSFHGGLIGVIVAMLVTAKLQ KRNFWVVADFVAPLIPFGLGMGRIGNFINDELWGRVTDVPWAVLFPSGGYLPRHPSQLYE FVLEGIVLFCILNWFIRKPRPAGSVAGLFLLFYGLFRFIVEFFREPDAQLGLYFGQQISM GQILSTPMILLGALFIVLAYRRRSAVKN
Uniprot No.

Target Background

Function

This recombinant Mannheimia succiniciproducens Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links

KEGG: msu:MS0406

STRING: 221988.MS0406

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in bacterial systems like M. succiniciproducens?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first critical step in bacterial lipoprotein biosynthesis by transferring a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox of prolipoproteins. This modification occurs via a thioether bond formation and is essential for proper lipoprotein maturation and localization. In Gram-negative bacteria like M. succiniciproducens, this process initiates a cascade that ultimately results in triacylated lipoproteins that are transported to the outer membrane where they perform diverse functions including structural support, nutrient acquisition, and signaling .

The reaction catalyzed by Lgt produces glycerol phosphate as a byproduct. When using a racemic phosphatidylglycerol substrate in biochemical assays, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) can be detected, which forms the basis for many activity assays . The function of Lgt appears to be highly conserved across bacterial species, with studies in E. coli demonstrating it is essential for bacterial viability, as confirmed through depletion studies .

What expression systems are most suitable for recombinant production of M. succiniciproducens Lgt?

When expressing recombinant M. succiniciproducens Lgt, several expression systems can be considered, each with distinct advantages:

E. coli-based expression systems:

  • BL21(DE3) with pET vector system: Optimal for initial expression trials due to strong induction via T7 promoter

  • C41(DE3) or C43(DE3) strains: Specifically engineered for membrane protein expression, reducing toxicity associated with membrane protein overexpression

  • pBAD vector system: Provides tunable expression through arabinose induction, critical for potentially toxic membrane proteins

Methodology for optimized expression:

  • Clone the M. succiniciproducens lgt gene into expression vectors with appropriate affinity tags (His6 or Strep-tag II) at either N- or C-terminus

  • Transform into expression hosts and screen multiple colonies for expression

  • Optimize expression conditions by varying:

    • Induction temperature (typically 16-30°C for membrane proteins)

    • Inducer concentration

    • Expression duration (4-24 hours)

    • Media composition (consider supplementation with phospholipids)

Given that E. coli Lgt is an inner membrane protein with seven transmembrane segments , similar topology would be expected for M. succiniciproducens Lgt, making membrane protein-specific expression strategies necessary. Detergent screening is critical during purification, with commonly used detergents including n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), and lauryl maltose neopentyl glycol (LMNG).

How do you confirm the activity of recombinant M. succiniciproducens Lgt in vitro?

Confirming the enzymatic activity of recombinant M. succiniciproducens Lgt requires robust biochemical assays that can detect the transfer of diacylglyceryl from phosphatidylglycerol to peptide substrates. Several methodological approaches can be implemented:

Glycerol phosphate release assay:

  • Prepare a reaction mixture containing purified recombinant Lgt, phosphatidylglycerol substrate, and a synthetic peptide substrate containing the conserved lipobox sequence

  • Incubate the reaction at physiological temperature (30-37°C) for a defined period

  • Measure the release of glycerol phosphate using a coupled enzymatic assay with luciferase detection

  • Compare activity to known Lgt enzymes (e.g., E. coli Lgt) as positive controls

Radiolabeled substrate approach:

  • Use phosphatidylglycerol labeled with 14C or 3H in the fatty acid chains

  • Incubate with Lgt and peptide substrate

  • Extract lipids and analyze by thin-layer chromatography

  • Visualize and quantify by autoradiography or phosphoimaging

Peptide modification detection:

  • Employ mass spectrometry to detect the mass shift in peptide substrates after diacylglyceryl modification

  • Use HPLC to separate modified from unmodified peptides

  • Apply Western blot analysis using antibodies specific to lipidated proteins

The successful detection of diacylglyceryl transfer activity would confirm that the recombinant enzyme is properly folded and functional. Kinetic parameters (Km, Vmax) should be determined using varying concentrations of both phosphatidylglycerol and peptide substrates to fully characterize the enzyme's biochemical properties.

What are the conserved domains and essential residues in Lgt that would likely be present in M. succiniciproducens Lgt?

Based on comparative analysis of Lgt proteins across bacterial species, M. succiniciproducens Lgt would likely contain several highly conserved domains and critical residues essential for its function:

Key conserved elements:

  • The Lgt signature motif, a characteristic sequence that faces the periplasmic side of the membrane in Gram-negative bacteria

  • Seven transmembrane segments that anchor the protein in the inner membrane

  • Critical catalytic residues, which in E. coli include:

    • Y26, N146, and G154: Absolutely required for Lgt function

    • R143, E151, R239, and E243: Important but not strictly essential

The conservation pattern suggests these residues participate directly in substrate binding or catalysis. The membrane topology, with the N-terminus facing the periplasm and the C-terminus in the cytoplasm, is likely conserved in M. succiniciproducens Lgt as it is critical for proper substrate access and catalytic function.

Studies using site-directed mutagenesis would be necessary to confirm which specific residues are essential in the M. succiniciproducens enzyme. Based on sequence alignment with E. coli Lgt, the corresponding residues could be mutated to alanine and the resulting variants tested for complementation in a conditional lgt depletion strain, similar to studies performed with E. coli Lgt .

What experimental approaches can be used to identify potential inhibitors of M. succiniciproducens Lgt?

Identifying inhibitors of M. succiniciproducens Lgt requires a multi-faceted approach combining high-throughput screening with detailed mechanistic studies:

Primary screening strategies:

  • Biochemical high-throughput screening (HTS):

    • Develop a miniaturized version of the glycerol phosphate release assay

    • Screen compound libraries (10,000-1,000,000 compounds)

    • Use fluorescence or luminescence-based detection for increased sensitivity

    • Identify compounds with IC50 values in the micromolar to nanomolar range

  • Fragment-based screening:

    • Use surface plasmon resonance (SPR) or differential scanning fluorimetry (DSF)

    • Identify low molecular weight compounds that bind to Lgt

    • Combine fragments to develop more potent inhibitors

Secondary confirmation assays:

  • Cellular activity validation:

    • Test compounds in M. succiniciproducens or surrogate organisms

    • Monitor accumulation of unmodified prolipoproteins by Western blot

    • Assess outer membrane integrity using permeability assays

  • Mechanism of action studies:

    • Determine if inhibitors compete with phosphatidylglycerol or prolipoprotein substrates

    • Analyze enzyme kinetics in the presence of inhibitors

    • Use mutagenesis to identify residues involved in inhibitor binding

  • Structural studies:

    • Co-crystallize Lgt with identified inhibitors

    • Use cryo-EM for structure determination if crystallization proves challenging

    • Employ molecular docking and molecular dynamics simulations

Recent work has identified the first Lgt inhibitors for E. coli that potently inhibit Lgt biochemical activity in vitro and are bactericidal against wild-type bacteria . These compounds (designated G9066, G2823, and G2824) had IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively . They could serve as important starting points or positive controls for screening efforts targeting M. succiniciproducens Lgt.

How does inhibition of Lgt in M. succiniciproducens potentially affect bacterial physiology compared to other bacterial species?

Inhibition of Lgt in M. succiniciproducens would likely have profound effects on bacterial physiology, though specific differences from other species would need to be determined experimentally:

Expected cellular consequences of Lgt inhibition:

  • Accumulation of unmodified prolipoproteins:

    • Western blot analysis would reveal the presence of unmodified pro-Lpp (UPLP) in the inner membrane, similar to what has been observed in E. coli

    • This accumulation would disrupt the normal lipoprotein processing pathway

  • Outer membrane integrity compromise:

    • Improper lipoprotein processing would lead to defects in outer membrane structure

    • Increased permeability to hydrophobic compounds and antibiotics

    • Enhanced sensitivity to serum killing due to compromised membrane barriers

  • Disruption of peptidoglycan-outer membrane linkage:

    • In E. coli, inhibition of Lgt reduces efficient crosslinking of Lpp to peptidoglycan

    • This would likely occur in M. succiniciproducens as well, leading to cell envelope instability

  • Species-specific considerations:

    • Comparative genomic analysis of M. succiniciproducens should be performed to identify all predicted lipoproteins

    • The specific functions of these lipoproteins would determine which physiological processes are most affected

    • Differences in the relative importance of lipoprotein-dependent functions could result in varied sensitivity to Lgt inhibition

Importantly, studies in E. coli have shown that unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests that inhibition of Lgt affects multiple essential lipoproteins beyond just Lpp, making it a potentially robust antibacterial target with a higher barrier to resistance development.

What methodological approaches can be used to determine the crystal structure of M. succiniciproducens Lgt?

Determining the crystal structure of M. succiniciproducens Lgt presents significant challenges due to its nature as a transmembrane protein. The following methodological approaches can be employed:

Protein preparation strategies:

  • Construct optimization:

    • Create multiple constructs with varied N- and C-terminal boundaries

    • Remove flexible regions that might hinder crystallization

    • Introduce mutations to increase stability or reduce surface entropy

  • Fusion protein approaches:

    • Insert T4 lysozyme or BRIL (thermostabilized apocytochrome b562) into loops to increase polar surface area

    • Use antibody fragments (Fab or nanobodies) to stabilize specific conformations

    • Apply the GPCR crystallization approach of fusing stabilizing proteins to terminal regions

  • Detergent and lipid optimization:

    • Screen multiple detergents (DDM, DM, LMNG, etc.) for protein extraction

    • Test lipid cubic phase (LCP) crystallization methods

    • Include specific lipids important for stability

Crystallization approaches:

  • Vapor diffusion:

    • Set up hanging or sitting drop vapor diffusion trials with commercial screens

    • Optimize promising conditions by varying pH, salt, precipitant, and additive concentrations

    • Use microseeding to improve crystal quality

  • Lipidic cubic phase (LCP):

    • Reconstitute purified Lgt in monoolein or other lipids

    • Set up LCP crystallization trials

    • Optimize using additives specific for membrane protein crystallization

  • Alternative crystallization methods:

    • Bicelle crystallization

    • Vesicle fusion

    • Counter-diffusion methods

If crystallization proves exceptionally challenging, alternative structural determination methods should be considered:

  • Single-particle cryo-electron microscopy (cryo-EM)

  • Electron crystallography

  • Nuclear magnetic resonance (NMR) for specific domains

  • Small-angle X-ray scattering (SAXS) for low-resolution envelope

The successful determination of Lgt structure would provide invaluable insights into its catalytic mechanism and facilitate structure-based drug design efforts targeting this essential enzyme.

How can site-directed mutagenesis be used to identify essential catalytic residues in M. succiniciproducens Lgt?

Site-directed mutagenesis represents a powerful approach to identify catalytic and structurally important residues in M. succiniciproducens Lgt:

Experimental design:

  • Target residue selection:

    • Identify conserved residues through multiple sequence alignment of Lgt proteins

    • Focus on residues within predicted transmembrane domains and the Lgt signature motif

    • Include residues corresponding to Y26, N146, G154, R143, E151, R239, and E243 in E. coli Lgt, which have been shown to be critical for function

  • Mutagenesis approach:

    • Create alanine substitutions of selected residues

    • For charged residues, consider both alanine substitutions and charge reversals

    • Generate conservative substitutions to distinguish between structural and catalytic roles

  • Functional complementation testing:

    • Develop a conditional M. succiniciproducens lgt depletion strain

    • Transform with plasmids expressing wildtype or mutant Lgt variants

    • Assess growth under depletion conditions

    • Classify mutations as:

      • Non-functional: No complementation of growth defect

      • Partially functional: Reduced growth compared to wildtype

      • Fully functional: Complete restoration of growth

  • Biochemical characterization:

    • Purify recombinant mutant proteins

    • Measure enzymatic activity using the glycerol phosphate release assay

    • Determine kinetic parameters (Km, kcat) for partially active mutants

    • Assess protein stability through thermal shift assays

Data analysis approach:

  • Correlate sequence conservation with functional importance

  • Create a topological map of essential residues

  • Use the data to inform computational models of the active site

  • Categorize residues as involved in substrate binding, catalysis, or structural integrity

This systematic approach would generate a functional map of the enzyme, identifying residues critical for its activity. The results could then be compared with known data from E. coli Lgt to identify conserved and divergent features, potentially revealing species-specific characteristics that could be exploited for selective inhibition.

What are the challenges in measuring kinetic parameters of recombinant M. succiniciproducens Lgt and how can they be overcome?

Determining accurate kinetic parameters for recombinant M. succiniciproducens Lgt presents several technical challenges due to its membrane protein nature and complex substrates:

Key challenges and solutions:

  • Membrane protein solubilization:

    • Challenge: Maintaining enzyme activity in detergent micelles

    • Solution:

      • Systematic screening of detergents (DDM, DM, LMNG, etc.)

      • Testing of lipid-detergent mixed micelles

      • Nanodisc reconstitution to provide a native-like membrane environment

  • Substrate presentation:

    • Challenge: Phosphatidylglycerol substrate delivery in aqueous solution

    • Solution:

      • Use of detergent micelles containing phosphatidylglycerol

      • Liposome incorporation of substrates

      • Development of water-soluble substrate analogs

  • Coupled assay interference:

    • Challenge: Detergents can interfere with coupled enzyme assays

    • Solution:

      • Validate assay components in the presence of used detergents

      • Develop direct detection methods (HPLC, MS) that don't rely on coupled enzymes

      • Use of fluorescently-labeled substrates for direct monitoring

  • Experimental design for accurate measurements:

    ParameterExperimental ApproachData Analysis Method
    Km for peptide substrateVary peptide concentration (0.1-10× estimated Km) with fixed phosphatidylglycerolNon-linear regression to Michaelis-Menten equation
    Km for phosphatidylglycerolVary phosphatidylglycerol (0.1-10× estimated Km) with fixed peptideNon-linear regression to Michaelis-Menten equation
    kcatMeasure reaction rates with saturating substratesCalculate from Vmax and enzyme concentration
    Specificity for different phospholipidsCompare reaction rates with different phospholipid substratesCalculate relative efficiency (kcat/Km)
  • Reaction progress monitoring:

    • Challenge: Limited sensitivity of glycerol phosphate detection

    • Solution:

      • Develop a luminescence-based detection system similar to that used for E. coli Lgt

      • Use radiolabeled substrates for increased sensitivity

      • Apply mass spectrometry to directly detect modified peptides

By addressing these methodological challenges, researchers can obtain reliable kinetic parameters that accurately reflect the catalytic properties of M. succiniciproducens Lgt. These parameters are essential for comparing the enzyme to Lgt from other species and for evaluating the potency and mechanism of potential inhibitors.

How can molecular dynamics simulations help understand the catalytic mechanism of M. succiniciproducens Lgt?

Molecular dynamics (MD) simulations provide powerful computational tools for investigating the structural dynamics and catalytic mechanism of M. succiniciproducens Lgt at an atomic level:

Simulation setup and methodology:

  • System preparation:

    • Build a homology model of M. succiniciproducens Lgt based on available structures or predicted models

    • Embed the protein in a lipid bilayer mimicking bacterial inner membrane composition

    • Add explicit water molecules and appropriate ions

    • Include substrate molecules (phosphatidylglycerol and peptide containing lipobox)

  • Simulation protocols:

    • Perform equilibration simulations (50-100 ns) to stabilize the system

    • Run production simulations (multiple microseconds) to observe conformational changes

    • Use enhanced sampling techniques such as:

      • Steered MD to investigate substrate binding and product release

      • Umbrella sampling to determine free energy profiles along reaction coordinates

      • Metadynamics to explore conformational space and identify metastable states

  • Analysis approaches:

    • Track distances between catalytic residues and substrates

    • Monitor water molecule positions to identify potential nucleophilic activation

    • Analyze hydrogen bonding networks and salt bridges

    • Calculate binding free energies using MM/PBSA or MM/GBSA methods

Specific catalytic insights:

  • Identification of residues involved in phosphatidylglycerol binding and orientation

  • Determination of the prolipoprotein binding site and interaction mode

  • Elucidation of the reaction mechanism for diacylglyceryl transfer

  • Understanding conformational changes associated with substrate binding and product release

Validation and refinement:

  • Compare simulation predictions with experimental mutagenesis data

  • Design experiments to test hypotheses generated from simulations

  • Iteratively refine the model based on experimental feedback

MD simulations would complement experimental approaches by providing atomic-level insights into transient states and conformational changes that are difficult to capture experimentally. This information would be invaluable for understanding the catalytic mechanism and for the rational design of inhibitors targeting specific mechanistic steps.

What are the optimal conditions for purifying recombinant M. succiniciproducens Lgt while maintaining its activity?

Purifying recombinant M. succiniciproducens Lgt requires careful optimization to maintain its native conformation and enzymatic activity:

Purification strategy and conditions:

  • Cell disruption and membrane preparation:

    • Lyse cells using gentle methods (e.g., French press or sonication with cooling)

    • Separate membranes by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membranes to remove peripheral proteins

  • Solubilization optimization:

    • Screen detergents at concentrations 2-5× their critical micelle concentration:

      • Mild detergents: DDM, LMNG, GDN

      • Mixed detergent systems: DDM/CHS, LMNG/CHS

    • Optimize solubilization conditions:

      • Temperature: 4°C is typically optimal

      • Time: 1-3 hours with gentle agitation

      • Buffer composition: Include glycerol (10-20%) and appropriate salt concentration

  • Chromatography steps:

    • Immobilized metal affinity chromatography (IMAC):

      • Use Ni-NTA or TALON resin for His-tagged protein

      • Include low concentrations of detergent in all buffers

      • Employ step or shallow gradient elution with imidazole

    • Size exclusion chromatography (SEC):

      • Separate protein-detergent complexes from aggregates and free detergent

      • Select appropriate column (Superdex 200 or Superose 6)

      • Monitor protein quality by analyzing SEC profile

  • Activity preservation measures:

    • Add phospholipids (E. coli total lipid extract or defined mixtures) during purification

    • Maintain pH between 7.0-8.0 throughout purification

    • Include stabilizing agents:

      • Glycerol (10-20%)

      • Reducing agents (DTT or TCEP at 1-5 mM)

      • Protease inhibitors

  • Quality control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify protein identity by mass spectrometry

    • Confirm proper folding through circular dichroism spectroscopy

    • Measure specific activity after each purification step to track activity retention

Successful purification would yield homogeneous, active enzyme suitable for biochemical and structural studies. The optimal conditions should balance the need for high purity with maintenance of the native conformation and catalytic activity of the enzyme.

How can CRISPR-Cas9 technology be applied to create conditional lgt mutants in M. succiniciproducens?

Developing conditional lgt mutants in M. succiniciproducens using CRISPR-Cas9 technology involves several sophisticated genetic engineering steps:

System development and methodological approach:

  • Vector construction for CRISPR-Cas9 delivery:

    • Design plasmids containing:

      • Cas9 under control of a constitutive or inducible promoter

      • sgRNA expression cassette targeting the lgt gene

      • Homology-directed repair (HDR) template

    • Ensure plasmid compatibility with M. succiniciproducens (appropriate origins of replication and selection markers)

  • Conditional mutant design strategies:

    • Promoter replacement approach:

      • Replace the native lgt promoter with an inducible system (e.g., tetracycline-inducible)

      • Design HDR template with inducible promoter flanked by homology arms

      • Include reporter gene (e.g., GFP) to monitor expression levels

    • Degron tag approach:

      • Fuse a degron tag to Lgt C-terminus

      • Use an inducible degron system that triggers protein degradation upon inducer addition

      • Design HDR template with degron sequence flanked by homology arms

    • CRISPRi approach:

      • Develop catalytically inactive Cas9 (dCas9) system

      • Design sgRNAs targeting the lgt promoter region

      • Create inducible expression of dCas9 and sgRNA to reversibly repress lgt transcription

  • Transformation and selection protocol:

    • Optimize electroporation conditions for M. succiniciproducens

    • Select transformants on appropriate antibiotics

    • Screen colonies for successful integration using PCR and sequencing

    • Verify conditional expression/depletion by Western blot

  • Validation of conditional phenotype:

    • Growth curves under inducing and non-inducing conditions

    • Western blot analysis of Lgt levels

    • Lipoprotein modification analysis

    • Microscopy to assess morphological changes

    • Membrane integrity assays

  • Potential challenges and solutions:

    ChallengeSolution
    Low transformation efficiencyOptimize electroporation parameters; use methylation-deficient E. coli for plasmid preparation
    Off-target CRISPR effectsCareful sgRNA design with specificity analysis; use high-fidelity Cas9 variants
    Leaky expression in conditional systemsTest multiple inducible systems; optimize RBS strength
    Polar effects on downstream genesDesign constructs that maintain operon structure; introduce compensatory promoters

The resulting conditional mutants would be valuable tools for studying the essentiality of lgt in M. succiniciproducens and for evaluating the effects of Lgt depletion on bacterial physiology and envelope integrity. They would also provide a platform for testing potential inhibitors targeting Lgt.

What are the comparative differences between Lgt enzymes from M. succiniciproducens and other well-studied bacterial species?

A comparative analysis of Lgt enzymes from M. succiniciproducens and other bacterial species reveals important insights into conservation and divergence:

Sequence and structural comparison:

  • Primary sequence analysis:

    • While specific data on M. succiniciproducens Lgt is limited in the provided search results, comparative genomics would likely reveal:

      • Conservation of the Lgt signature motif containing invariant residues

      • Preservation of key catalytic residues (corresponding to Y26, N146, G154, R143, E151, R239, and E243 in E. coli)

      • Species-specific variations in non-catalytic regions

  • Predicted structural features:

    • M. succiniciproducens Lgt would likely share the seven-transmembrane topology of E. coli Lgt

    • The N-terminus would face the periplasm and the C-terminus the cytoplasm

    • The conserved Lgt signature motif would be positioned facing the periplasm

Functional comparison:

  • Substrate specificity:

    • Based on knowledge of lipoprotein biosynthesis pathways, M. succiniciproducens Lgt would likely:

      • Utilize phosphatidylglycerol as the preferred diacylglyceryl donor

      • Recognize similar lipobox motifs ([LVI][ASTVI][GAS]C) in prolipoprotein substrates

      • Display potential differences in efficiency toward specific prolipoproteins

  • Biochemical properties:

    • Comparative analysis of purified recombinant Lgt enzymes could reveal differences in:

      • Catalytic efficiency (kcat/Km)

      • pH and temperature optima

      • Detergent and lipid preferences for optimal activity

      • Sensitivity to inhibitors

Physiological context:

  • Genomic context and regulation:

    • Analysis of the M. succiniciproducens genome would provide insights into:

      • Organization of lgt in potential operons

      • Regulatory elements controlling lgt expression

      • Co-regulation with other envelope biogenesis genes

  • Lipoprotein repertoire:

    • Bioinformatic prediction of M. succiniciproducens lipoproteins would identify:

      • Total number of lipoproteins compared to other species

      • Functional categories represented

      • Species-specific lipoproteins that might influence Lgt importance

Understanding these comparative differences would provide valuable insights for both fundamental bacterial physiology research and applied studies aimed at developing species-selective inhibitors. This knowledge would also inform experimental design when working with recombinant M. succiniciproducens Lgt, highlighting potential special considerations for expression, purification, and activity assays.

How does inhibition of Lgt in M. succiniciproducens compare to traditional antibiotic targets in terms of resistance development potential?

Targeting Lgt in M. succiniciproducens presents unique considerations for resistance development compared to traditional antibiotic targets:

Resistance mechanisms analysis:

  • Target modification resistance:

    • Lgt performs an essential function with highly conserved catalytic residues

    • Mutations in the active site would likely compromise enzyme function

    • Studies in E. coli have shown difficulty in raising on-target resistant mutants to Lgt inhibitors

    • This suggests a high genetic barrier to resistance through target modification

  • Bypass mechanism evaluation:

    • Unlike other lipoprotein biosynthesis enzymes, inhibition of Lgt in E. coli cannot be rescued by deletion of lpp

    • In fact, Lpp appears to be protective rather than contributing to toxicity when Lgt is inhibited

    • This indicates multiple essential lipoproteins beyond Lpp are affected by Lgt inhibition

    • The requirement for multiple compensatory adaptations raises the barrier for resistance development

  • Efflux-based resistance potential:

    • As with any antimicrobial, efflux pumps could potentially reduce intracellular concentrations of Lgt inhibitors

    • This common resistance mechanism would depend on the chemical properties of specific inhibitors

    • Efflux pump inhibitors could be co-administered to counter this potential resistance mechanism

  • Comparative resistance barrier analysis:

    Antibiotic ClassPrimary Resistance MechanismsResistance Development RateLgt Inhibition Comparison
    β-lactamsTarget modification (PBPs), β-lactamasesRapidHigher barrier due to essential nature and multiple affected pathways
    FluoroquinolonesTarget mutations (DNA gyrase), effluxIntermediatePotentially similar barriers for target mutation but different cellular impacts
    AminoglycosidesTarget modification (rRNA), modifying enzymesIntermediateLower risk of enzymatic inactivation for Lgt inhibitors
    PolymyxinsLPS modifications, effluxSlowSimilar as both target membrane integrity, but different mechanisms
  • Empirical evidence:

    • Studies in E. coli have shown that researchers were "unable to raise on-target resistant mutants to any Lgti"

    • This observation aligns with the hypothesis that Lgt inhibitors may have a high barrier to resistance

    • Further studies specifically in M. succiniciproducens would be needed to confirm similar resistance characteristics

The data from E. coli suggests that Lgt represents a promising antibacterial target with potentially favorable resistance development characteristics. The multi-faceted impact of Lgt inhibition on outer membrane integrity, coupled with the inability of lpp deletion to rescue growth, indicates a complex physiological response that would require multiple adaptive changes to overcome, potentially raising the barrier to resistance development compared to traditional single-enzyme targets.

What experimental approaches can be used to study the effects of Lgt inhibition on M. succiniciproducens membrane proteome?

Investigating how Lgt inhibition affects the M. succiniciproducens membrane proteome requires sophisticated proteomics approaches combined with membrane biology techniques:

Experimental workflow and methodological considerations:

  • Conditional depletion system development:

    • Create an inducible lgt depletion strain as described in section 3.2

    • Establish conditions for partial and complete Lgt depletion

    • Include appropriate control strains (wild-type, complemented mutant)

  • Membrane fractionation techniques:

    • Inner membrane isolation:

      • Separate inner and outer membranes using sucrose density gradient centrifugation

      • Alternatively, use selective detergent solubilization with sarkosyl, which specifically solubilizes inner membrane proteins

      • Verify fraction purity using marker proteins (e.g., NADH oxidase for IM, porins for OM)

    • Outer membrane isolation:

      • Extract with carbonate buffer to remove peripheral proteins

      • Collect outer membrane by ultracentrifugation

      • Verify purity through electron microscopy and marker proteins

  • Proteomic analysis approaches:

    • Quantitative proteomics:

      • Label-free quantification (LFQ) using high-resolution mass spectrometry

      • Isotope labeling methods (SILAC, iTRAQ, or TMT) for improved quantification

      • Data-independent acquisition (DIA) for comprehensive protein detection

    • Lipoprotein-specific analysis:

      • Selective enrichment of lipoproteins using detergent extraction

      • Palmitate labeling using click chemistry for specific detection

      • Targeted multiple reaction monitoring (MRM) for key lipoproteins

  • Post-translational modification analysis:

    • Identify accumulation of unmodified prolipoprotein forms

    • Characterize lipoprotein processing intermediates

    • Compare lipid modifications using specialized MS techniques

  • Functional correlation studies:

    • Correlate proteomic changes with membrane permeability alterations

    • Analyze impacts on specific physiological pathways

    • Measure antibiotic susceptibility changes

  • Visualization techniques:

    • Immunofluorescence microscopy to track specific lipoprotein localization

    • Electron microscopy to examine membrane ultrastructure

    • Atomic force microscopy to analyze cell surface properties

Expected outcomes and analysis:

  • Identification of all lipoproteins affected by Lgt inhibition

  • Quantification of processing intermediates

  • Discovery of potential compensatory changes in membrane composition

  • Correlation of specific lipoprotein processing defects with phenotypic consequences

This comprehensive approach would provide crucial insights into how Lgt inhibition affects the membrane proteome of M. succiniciproducens, revealing both direct impacts on lipoprotein processing and secondary adaptations that might occur in response to disruption of this essential pathway. The findings would enhance understanding of bacterial membrane biology and inform the development of Lgt-targeting antimicrobials.

What are the most promising future research directions for studying recombinant M. succiniciproducens Lgt?

The study of recombinant M. succiniciproducens Lgt offers several promising research avenues that could significantly advance our understanding of bacterial lipoprotein processing and antimicrobial development:

High-impact research directions:

  • Structural biology initiatives:

    • Determination of the three-dimensional structure of M. succiniciproducens Lgt through X-ray crystallography, cryo-EM, or integrated computational-experimental approaches

    • Mapping of substrate binding sites and catalytic regions

    • Comparative structural analysis with Lgt enzymes from other bacterial species

    • Structure-based drug design targeting specific features of the catalytic site

  • Mechanistic investigations:

    • Detailed enzymatic characterization using pre-steady-state kinetics

    • Identification of reaction intermediates using specialized spectroscopic techniques

    • Elucidation of the precise catalytic mechanism through combined mutagenesis and computational approaches

    • Investigation of potential allosteric regulation mechanisms

  • Systems biology approaches:

    • Global analysis of the impacts of Lgt inhibition on the bacterial cell

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify compensatory pathways activated upon Lgt inhibition

    • Identification of synthetic lethal interactions that could be exploited therapeutically

  • Translational research opportunities:

    • Development of high-throughput screening platforms specific for M. succiniciproducens Lgt

    • Medicinal chemistry optimization of lead compounds identified in initial screens

    • Investigation of species selectivity determinants for inhibitor design

    • Exploration of combination therapies leveraging Lgt inhibition with other antimicrobial mechanisms

  • Technological innovations:

    • Development of improved expression systems for membrane protein production

    • Creation of novel assay methods for Lgt activity with increased sensitivity and throughput

    • Application of advanced imaging techniques to visualize lipoprotein trafficking in live cells

    • Utilization of genome editing technologies to create precise mutations for functional studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.