Recombinant Mannheimia succiniciproducens Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag type.
Synonyms
htpX; MS1134; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Mannheimia succiniciproducens (strain MBEL55E)
Target Names
htpX
Target Protein Sequence
MMRILLFLATNAAVLIVFNIILSLTGIRGQDAMGLLIMAALFGFTGSIISLLMSKRSALA ATGAEVIEQPRNDTERWLLQTVHSQAEKAGLPKPDVAIYHSNDVNAFATGASKNNSLVAV STALLNNMTRDEAEGVLAHEISHIKNGDMVTMTLLQGVLNTFVIFAARMIARMVANNRSS EESNSGIYFLVAMVLEVVFGFLASMIAMWFSRFREFRADAGSAELAGKQKMIAALKRLQA IHEPQEMDGKLAAFAINGKRGGFTSLFLSHPPLEKRIEALETSK
Uniprot No.

Target Background

Database Links

KEGG: msu:MS1134

STRING: 221988.MS1134

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Mannheimia succiniciproducens Protease HtpX and what are its fundamental properties?

Mannheimia succiniciproducens Protease HtpX is likely a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. Based on homology with the better-characterized Escherichia coli HtpX, it is expected to be an integral membrane protein involved in the quality control of membrane proteins. The E. coli HtpX contains four hydrophobic regions (H1-H4) that function as transmembrane segments, though the membrane embedding of the two C-terminal regions remains controversial . The protease likely contains a zinc-binding motif essential for its proteolytic activity and contributes to the degradation of misfolded or damaged membrane proteins, maintaining membrane integrity and function. The exact sequence and structural differences between M. succiniciproducens HtpX and its E. coli counterpart would require specific sequence alignment and structural prediction analyses.

How does HtpX function in bacterial membrane protein quality control?

HtpX functions as part of the proteolytic quality control machinery for membrane proteins. In E. coli, HtpX has been characterized as a membrane-embedded protease that works in conjunction with other quality control systems to identify, cleave, and facilitate the removal of misfolded or damaged membrane proteins . The protease contains a catalytic domain with a zinc-binding motif typical of M48 metalloproteinases. When membrane proteins become misfolded or damaged, HtpX recognizes specific structural features or exposed domains and cleaves these proteins, initiating their degradation and preventing toxic accumulation in the membrane. Recent research has developed model substrates and in vivo assay systems for studying HtpX activity, which has advanced understanding of its functional mechanisms . Specifically, these assays have enabled detection of differential protease activities in HtpX mutants carrying mutations in conserved regions, providing insights into structure-function relationships.

What is the relationship between Mannheimia succiniciproducens metabolism and HtpX function?

While direct experimental evidence linking M. succiniciproducens metabolism to HtpX function is limited, we can extrapolate from related research. M. succiniciproducens MBEL55E efficiently produces succinic acid from various carbon sources, including pentose sugar (xylose), hexose sugars (fructose and glucose), and disaccharides (lactose, maltose, and sucrose) . The bacterium utilizes specialized transport systems such as the phosphotransferase system (PTS) for carbon uptake. Membrane proteases like HtpX likely play crucial roles in maintaining the integrity and function of these transport systems by removing damaged components.

Research in related organisms suggests that HtpX is involved in quality control of envelope proteins, which would include membrane transporters essential for carbon source utilization . Additionally, protein levels of envelope quality control components, including HtpX, have been shown to be significantly affected (roughly two times stronger than expected) under certain stress conditions . This suggests that M. succiniciproducens HtpX may play an important role in adapting to environmental stresses, potentially including changes in carbon source availability or metabolic shifts.

What experimental approaches are most effective for characterizing the substrate specificity of recombinant M. succiniciproducens HtpX?

For characterizing substrate specificity of recombinant M. succiniciproducens HtpX, a multi-tiered experimental approach is recommended:

  • Model Substrate Development: Design model substrates similar to the HtpX model substrate 1 (XMS1) developed for E. coli HtpX . Such substrates typically contain recognition motifs accessible to the protease and reporter tags (such as msfGFP) for detection of cleavage products. The substrate should be designed with transmembrane segments that position potential cleavage sites appropriately relative to the membrane.

  • In Vivo Protease Activity Assay: Implement a semiquantitative in vivo assay system similar to that established for E. coli HtpX . This system would involve expressing both the recombinant protease and model substrate in the same cell, followed by detection of cleavage products using immunoblotting or fluorescence measurements.

  • Site-Directed Mutagenesis: Create systematic mutations in the recombinant protease's conserved regions to identify residues critical for substrate recognition and catalysis. Comparing the activity of these mutants using the model substrate provides insights into the molecular basis of substrate specificity.

  • Comparative Analysis: Test potential physiological substrates identified through bioinformatic predictions or co-immunoprecipitation studies to validate their interaction with HtpX in vivo.

The table below summarizes key experimental parameters for these approaches:

Experimental ApproachKey ParametersDetection MethodExpected Outcomes
Model Substrate AnalysispH 7.0-8.0, 30-37°CImmunoblotting/FluorescenceCleavage patterns revealing recognition motifs
In Vivo AssayStandard growth conditionsWestern blot/SDS-PAGEQuantitative activity measurements
Mutagenesis StudiesConserved residue substitutionsActivity comparisonStructure-function relationships
Physiological Substrate TestingCo-expression conditionsCo-immunoprecipitationIdentification of natural substrates

How can researchers differentiate between the roles of HtpX and other proteases in M. succiniciproducens membrane protein quality control?

Differentiating between the roles of HtpX and other proteases in M. succiniciproducens requires systematic experimental approaches:

  • Gene Knockout Studies: Create single and combinatorial knockout strains targeting htpX and genes encoding other known membrane proteases. Phenotypic analysis including growth rates, stress resistance, and membrane protein profiles can reveal unique and overlapping functions. This approach has successfully identified functional roles for proteases in related organisms .

  • Complementation Experiments: Express wild-type or mutant versions of HtpX in knockout strains to determine which functions can be rescued, confirming specific roles attributable to HtpX rather than indirect effects.

  • Substrate Profiling: Use proteomics approaches to identify membrane proteins that accumulate in htpX knockout strains versus knockouts of other proteases. Techniques such as stable isotope labeling with amino acids in cell culture (SILAC) followed by mass spectrometry can provide quantitative comparisons.

  • Domain Swapping: Create chimeric proteases by swapping domains between HtpX and other membrane proteases to identify regions responsible for specific functions or substrate recognition patterns.

  • Conditional Expression Systems: Develop strains where HtpX or other proteases can be selectively induced or repressed to study temporal aspects of their function and potential compensatory mechanisms.

The specificity of HtpX function should be examined under various stress conditions, particularly those affecting membrane integrity, as the importance of envelope quality control proteins including HtpX has been shown to be significantly affected under certain stress conditions .

What are the optimal expression conditions for producing active recombinant M. succiniciproducens HtpX in heterologous systems?

Optimizing expression of active recombinant M. succiniciproducens HtpX in heterologous systems requires careful consideration of membrane protein expression challenges:

  • Expression Host Selection: E. coli C41(DE3) or C43(DE3) strains are recommended for membrane protein expression as they can accommodate higher levels of membrane proteins without toxicity. For higher eukaryotic systems, insect cells (Sf9 or High Five) using baculovirus expression may preserve more native-like membrane environments.

  • Vector Design: Incorporate a cleavable purification tag (His6/His10 or Strep-tag) at either N or C-terminus, similar to the tagged versions (HtpX-His6-Myc and HtpX-His10) used in E. coli HtpX studies . Include a weak to moderate strength promoter to prevent overwhelming the membrane insertion machinery.

  • Induction Parameters: Low inducer concentrations and reduced temperatures (16-25°C) generally improve membrane protein folding. For IPTG-inducible systems, concentrations of 0.1-0.5 mM IPTG and induction at OD600 of 0.6-0.8 are recommended starting points.

  • Membrane Mimetics for Purification: Screen detergents systematically for extraction and purification, beginning with mild non-ionic detergents (DDM, LMNG) or zwitterionic options (CHAPSO). Consider nanodiscs or amphipols for maintaining activity post-purification.

  • Activity Verification: Develop an in vitro activity assay using fluorogenic peptide substrates based on predicted cleavage sites or adapt the in vivo system described for E. coli HtpX .

The expression parameters should be systematically optimized using Design of Experiments (DoE) methodology, with activity measurements as the primary output variable. The table below summarizes optimal starting conditions:

ParameterRecommended ConditionAlternative OptionsMonitoring Method
Expression Temperature20°C16°C, 25°C, 30°CGrowth curve, yield
Induction Duration16-20 hours4-6 hours, overnightTime-course sampling
Detergent Extraction1% DDM1% LMNG, 1.5% CHAPSOExtraction efficiency
Buffer Composition20 mM Tris pH 8.0, 150 mM NaCl, 5% glycerolHEPES buffer systemsStability assays
Zinc Supplementation50-100 μM ZnCl2ZnSO4, zinc-chelator controlsActivity correlation

How should researchers interpret changes in HtpX activity in relation to M. succiniciproducens growth and metabolism?

Interpreting changes in HtpX activity in relation to M. succiniciproducens growth and metabolism requires multifaceted data analysis:

  • Growth Phase Correlation: Analyze HtpX activity across different growth phases using time-course sampling. M. succiniciproducens efficiently utilizes multiple carbon sources, including sucrose, through specialized transport systems . Examine whether HtpX activity changes during transitions between carbon sources or during shifts from exponential to stationary phase, which might indicate adaptive roles in modulating membrane protein composition.

  • Metabolic Flux Analysis: Integrate HtpX activity data with metabolic flux measurements, particularly focusing on succinic acid production pathways. Since M. succiniciproducens is valued for its efficient succinic acid production from various carbon sources , determine whether HtpX activity correlates with changes in metabolic flux, potentially through maintenance of key membrane transporters or metabolic enzymes.

  • Stress Response Patterns: Examine HtpX activity under various stressors (pH shifts, temperature changes, nutrient limitation). The involvement of HtpX in quality control of envelope proteins suggests its activity may be upregulated during stress conditions . Compare activity patterns with other stress response proteins to identify co-regulated networks.

  • Comparative Analysis Framework: Implement a statistical framework comparing wild-type and htpX mutant strains across multiple parameters. The following table provides a suggested analytical approach:

ParameterWild-type vs. ΔhtpX ComparisonStatistical AnalysisInterpretation Key
Growth RateComparison across carbon sourcesTwo-way ANOVA with post-hoc testsDecreased growth on specific carbon sources may indicate HtpX role in maintaining relevant transporters
Membrane Protein ProfilesQuantitative proteomicsDifferential abundance analysisAccumulation of specific proteins in mutants may identify substrates
Metabolite ProductionFocused on succinic acid yieldTime-series analysisChanges in production efficiency may reveal metabolic bottlenecks
Stress SurvivalRecovery after challengeSurvival curve comparisonDifferential survival indicates stress-specific roles
  • Multivariate Analysis: Apply principal component analysis or partial least squares discriminant analysis to identify patterns in multidimensional datasets combining transcriptomic, proteomic, and metabolomic data from wild-type and htpX mutant strains.

How can researchers design experiments to elucidate the role of HtpX in M. succiniciproducens stress response?

Designing experiments to elucidate HtpX's role in M. succiniciproducens stress response requires systematic approaches:

  • Stress Challenge Panel: Expose wild-type and ΔhtpX strains to a comprehensive panel of stressors:

    • pH stress (acidic and alkaline)

    • Temperature stress (heat shock and cold shock)

    • Oxidative stress (H2O2, paraquat)

    • Membrane disrupting agents (ethanol, detergents)

    • Nutrient limitation

    Monitor growth parameters, survival rates, and recovery times. Research has shown that HtpX and other envelope quality control proteins are significantly affected under stress conditions , making this a promising area for investigation.

  • Transcriptional Response Analysis: Perform RNA-seq comparing wild-type and ΔhtpX strains under normal and stress conditions. Analyze:

    • Differentially expressed genes (DEGs)

    • Enriched gene ontology (GO) terms

    • Altered regulatory networks

    • Stress-specific transcription factor activation

  • Proteome Stability Assessment: Implement pulse-chase labeling with stable isotopes to track protein turnover rates under stress conditions. Compare membrane protein half-lives between wild-type and ΔhtpX strains to identify HtpX-dependent degradation pathways.

  • Conditional Expression System: Develop a tunable expression system for HtpX to determine:

    • Threshold expression levels required for stress protection

    • Temporal requirements (pre-stress vs. during stress)

    • Dose-dependent effects on stress response pathways

  • Domain Mutation Analysis: Create strains expressing HtpX variants with mutations in:

    • Catalytic domains

    • Transmembrane regions

    • Potential regulatory domains

    This approach can identify which functional aspects of HtpX are critical for specific stress responses.

  • Cross-Complementation: Test whether HtpX from related species (e.g., E. coli) can rescue stress sensitivity phenotypes in M. succiniciproducens ΔhtpX strains, providing insights into conserved and species-specific functions.

What considerations are important when designing site-directed mutagenesis studies of M. succiniciproducens HtpX?

Site-directed mutagenesis studies of M. succiniciproducens HtpX require careful planning to yield meaningful structure-function insights:

  • Selection of Target Residues: Prioritize residues based on:

    • Conserved motifs identified through multiple sequence alignment with characterized HtpX homologs

    • Predicted catalytic residues in the zinc-binding HEXXH motif characteristic of M48 metalloproteinases

    • Residues in transmembrane domains potentially involved in substrate recognition

    • Interface residues that might mediate interactions with other proteins

    Research on E. coli HtpX has successfully used site-directed mutagenesis to identify functional regions, providing a methodological template .

  • Mutation Strategy Matrix:

Residue TypeMutation ApproachRationaleExpected Outcome
Catalytic residuesConservative (H→N, E→Q, D→N)Maintain structure while disrupting functionComplete loss of activity
Transmembrane residuesHydrophobicity alterationsTest membrane embedding requirementsAltered localization or stability
Interface residuesCharge reversalsDisrupt protein-protein interactionsContext-dependent functional changes
Conserved non-catalyticAlanine scanningIdentify functionally important regionsPartial activity reductions
  • Expression System Considerations:

    • Use low-copy number plasmids to avoid overexpression artifacts

    • Consider chromosomal integration for physiologically relevant expression levels

    • Include C-terminal or internal tags that don't interfere with function

    • Implement inducible promoters for tight expression control

  • Functional Assay Selection:

    • Adapt the in vivo protease activity assay developed for E. coli HtpX

    • Monitor both proteolytic activity and physiological function (stress response, growth)

    • Develop quantitative rather than qualitative readouts when possible

  • Structural Context Integration:

    • Generate or use homology models to interpret mutagenesis results

    • Consider dynamic structural aspects using molecular dynamics simulations

    • Analyze mutations in the context of predicted membrane topology

  • Combinatorial Mutagenesis Analysis:

    • Test epistatic interactions between mutations

    • Identify functional domains through regional mutagenesis

    • Create restoration-of-function pairs (e.g., charge swap experiments)

  • Controls and Validation:

    • Include positive controls (known inactivating mutations)

    • Negative controls (mutations in non-conserved, non-functional regions)

    • Verify protein expression levels for all mutants

    • Confirm proper membrane localization

The experimental design should include systematic documentation of mutagenesis outcomes in a standardized format to facilitate comparison across different mutants and experimental conditions.

How can researchers develop robust in vivo assays for measuring M. succiniciproducens HtpX activity?

Developing robust in vivo assays for M. succiniciproducens HtpX activity can be approached through adaptation of established methodologies:

  • Model Substrate Design Strategy:

    • Based on the E. coli HtpX model substrate (XMS1) approach , design chimeric proteins containing:

      • Transmembrane segments ensuring proper membrane localization

      • Putative HtpX recognition sequences

      • Reporter domains for easy detection (fluorescent proteins or epitope tags)

      • Cleavable linkers positioned at accessible locations

  • Expression System Configuration:

    • Dual-plasmid system with independently controllable expression of:

      • HtpX (wild-type or mutant variants)

      • Model substrate

    • Chromosomal integration options for stable expression

    • Inducible promoters with titratable expression levels

  • Detection Method Selection:

    • Western blotting with antibodies against N- and C-terminal tags

    • Fluorescence-based approaches if using fluorescent protein fusion partners

    • Mass spectrometry for precise cleavage site identification

    • Flow cytometry for single-cell analysis of cleavage efficiency

  • Quantification Approaches:

    • Densitometric analysis of Western blot bands

    • Ratio measurements of cleaved to uncleaved substrate

    • Time-course analysis to determine cleavage rates

    • Dose-response relationships between HtpX levels and substrate cleavage

  • Control Implementation:

    • Catalytically inactive HtpX mutants as negative controls

    • Non-cleavable substrate variants

    • Inhibitor controls (metalloprotease inhibitors like EDTA or 1,10-phenanthroline)

    • Positive controls using well-characterized proteases

  • Assay Optimization Parameters:

    • Growth phase dependence (exponential vs. stationary)

    • Media composition effects

    • Temperature sensitivity

    • Induction timing and duration

  • Validation Strategy:

    • Correlation with in vitro activity measurements

    • Comparison across multiple model substrates

    • Mutational analysis of both enzyme and substrate

The E. coli HtpX in vivo assay system provides a valuable template, as it enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions . The assay should be adapted for the specific characteristics of M. succiniciproducens, particularly considering its growth requirements as a capnophilic bacterium .

How should researchers interpret contradictory results when studying HtpX function in M. succiniciproducens?

Interpreting contradictory results in HtpX research requires systematic analysis and troubleshooting:

  • Contradiction Classification Framework:

    • Classify contradictions into categories:

      • Methodological contradictions (different assays giving different results)

      • Strain-dependent contradictions (variation between genetic backgrounds)

      • Condition-dependent contradictions (environmental factors affecting results)

      • Temporal contradictions (different results at different time points)

  • Biological Context Analysis:

    • Consider HtpX as part of integrated cellular networks rather than in isolation

    • Examine compensatory mechanisms that may mask phenotypes

    • Investigate condition-specific roles that may explain context-dependent results

    • Analyze the involvement of HtpX in quality control of envelope proteins, which can have complex downstream effects

  • Technical Reconciliation Approaches:

    • Standardize experimental conditions across studies

    • Implement orthogonal methods to verify key findings

    • Develop more sensitive assays for subtle phenotypes

    • Use time-resolved approaches to capture dynamic processes

  • Genetic Background Considerations:

    • Create clean genetic backgrounds by complementation

    • Test for suppressor mutations that may arise during strain construction

    • Consider polar effects of genetic manipulations

    • Implement Cre-lox or similar systems for marker-free manipulations

  • Data Integration Strategy:

    • Use network biology approaches to place contradictory results in context

    • Implement Bayesian frameworks for integrating multiple data types

    • Consider partial rather than binary functions (quantitative rather than qualitative roles)

    • Develop testable models that can accommodate seemingly contradictory observations

The table below presents a decision matrix for resolving common types of contradictions:

Contradiction TypeDiagnostic ApproachResolution StrategyInterpretation Framework
Activity vs. PhenotypeCompare direct vs. indirect measurementsIdentify compensatory pathwaysNetwork effects model
In vitro vs. In vivoTest environmental variables systematicallyRecreate relevant conditionsContextual activity paradigm
Strain DependenciesGenome sequencing of variant strainsIdentify genetic modifiersGenetic background model
Temporal InconsistenciesTime-course experimentsIdentify regulatory switchesDynamic regulation model

What are common technical challenges in studying M. succiniciproducens HtpX and how can they be addressed?

Researchers face several technical challenges when studying M. succiniciproducens HtpX, each requiring specific troubleshooting approaches:

  • Expression and Stability Issues:

    • Challenge: Poor expression or rapid degradation of recombinant HtpX

    • Solutions:

      • Optimize codon usage for expression host

      • Use fusion partners (MBP, SUMO) to enhance stability

      • Test multiple expression temperatures (16-30°C)

      • Include protease inhibitors throughout purification

      • Consider autoproteolysis effects and design autoproteolysis-resistant variants

  • Purification Challenges:

    • Challenge: Loss of activity during purification

    • Solutions:

      • Screen multiple detergents systematically

      • Implement gentle elution conditions

      • Supplement buffers with stabilizing agents (glycerol, specific lipids)

      • Use rapid purification protocols to minimize time

      • Maintain zinc (50-100 μM) in all buffers

  • Activity Detection Limitations:

    • Challenge: Low signal-to-noise in activity assays

    • Solutions:

      • Develop more sensitive fluorogenic substrates

      • Implement FRET-based assays for real-time monitoring

      • Use mass spectrometry for direct product detection

      • Concentrate samples appropriately without causing aggregation

      • Optimize assay conditions (buffer, pH, salt, temperature)

  • Genetic Manipulation Barriers:

    • Challenge: Difficult genetic manipulation of M. succiniciproducens

    • Solutions:

      • Optimize transformation protocols for this specific organism

      • Develop shuttle vectors compatible with M. succiniciproducens

      • Implement CRISPR-Cas9 systems adapted for this bacterium

      • Use counterselection methods for marker-free modifications

      • Consider heterologous expression in well-characterized hosts initially

  • Membrane Localization Verification:

    • Challenge: Confirming proper membrane insertion and topology

    • Solutions:

      • Implement GFP-fusion analysis with careful controls

      • Use membrane fractionation followed by Western blotting

      • Apply protease accessibility assays to map topology

      • Use epitope insertion combined with selective permeabilization

      • Consider advanced microscopy methods (STORM, PALM)

  • Substrate Identification Difficulties:

    • Challenge: Identifying physiological substrates

    • Solutions:

      • Use substrate-trapping mutants (active site mutations)

      • Implement quantitative proteomics comparing wild-type and knockout strains

      • Develop proximity labeling approaches

      • Use bioinformatic predictions based on known motifs

      • Apply comparative genomics across related species

For each challenge, a systematic troubleshooting approach should be implemented, starting with the least complex solutions and progressing to more sophisticated approaches as needed. Documentation of both successful and unsuccessful approaches contributes valuable methodological knowledge to the field.

What emerging technologies could advance our understanding of M. succiniciproducens HtpX structure and function?

Several cutting-edge technologies show promise for advancing HtpX research:

  • Cryo-Electron Microscopy Approaches:

    • Single-particle cryo-EM for high-resolution structure determination

    • Cryo-electron tomography to visualize HtpX in native membrane environments

    • Time-resolved cryo-EM to capture catalytic intermediates

    • These approaches could overcome the historical challenges of membrane protein crystallization

  • Advanced Genetic Tools:

    • CRISPR interference (CRISPRi) for tunable gene repression

    • Base editing for precise genomic modifications without double-strand breaks

    • Inducible degron systems for rapid protein depletion studies

    • These technologies would enable more sophisticated genetic manipulations in M. succiniciproducens

  • Proteomic Innovations:

    • Proximity labeling (BioID, APEX) to map the HtpX interactome

    • Limited proteolysis-coupled mass spectrometry to identify structural domains

    • Crosslinking mass spectrometry to capture transient substrate interactions

    • Thermal proteome profiling to identify condition-dependent interactions

    • These methods could reveal physiological substrates and regulatory partners

  • Single-Molecule Approaches:

    • Single-molecule FRET to monitor conformational changes during catalysis

    • Optical tweezers to measure forces involved in protein unfolding/degradation

    • High-speed AFM to visualize HtpX activity in real-time

    • These techniques could provide mechanistic insights at unprecedented resolution

  • Computational Advances:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Molecular dynamics simulations in explicit membrane environments

    • Machine learning for substrate prediction and specificity modeling

    • These computational tools could guide experimental design and interpretation

  • Microfluidic Systems:

    • Droplet microfluidics for high-throughput activity screening

    • Gradient generators to explore condition-dependent activities

    • Single-cell analysis platforms to study heterogeneity in responses

    • These systems enable examination of multiple conditions simultaneously

  • Metabolic Engineering Integration:

    • Synthetic biology approaches to create HtpX variants with novel specificities

    • Metabolic flux analysis to connect HtpX function with succinic acid production

    • Genome-scale models incorporating protease networks

    • These integrative approaches would connect HtpX function to the industrially relevant succinic acid production capabilities of M. succiniciproducens

The integration of these technologies would enable multidimensional analysis of HtpX, potentially revealing its precise role in membrane protein quality control and stress responses in M. succiniciproducens.

How might comparative studies between M. succiniciproducens HtpX and homologs from other bacteria enhance our understanding of protease evolution and adaptation?

Comparative studies offer powerful insights into evolutionary principles governing HtpX function:

  • Phylogenetic Analysis Frameworks:

    • Construct comprehensive phylogenetic trees of HtpX homologs across bacterial phyla

    • Map sequence conservation patterns to functional domains

    • Identify lineage-specific adaptations in substrate recognition regions

    • Correlate evolutionary patterns with bacterial ecological niches

  • Structure-Function Comparative Approaches:

    • Compare substrate specificity across diverse bacterial species

    • Identify conserved vs. variable residues in the active site and substrate-binding regions

    • Test cross-species complementation to assess functional conservation

    • These comparisons could reveal evolutionary constraints on HtpX function

  • Ecological Correlation Analysis:

    • Compare HtpX sequences from bacteria inhabiting diverse environments (extremophiles, mesophiles)

    • Analyze adaptations in species with specialized metabolism, such as M. succiniciproducens with its efficient succinic acid production

    • Study co-evolution patterns with substrate proteins across species

    • These analyses could reveal environment-specific adaptations

  • Regulatory Network Comparisons:

    • Examine how HtpX regulation differs across bacterial species

    • Identify conserved vs. species-specific regulatory elements

    • Map HtpX to different stress response networks across species

    • Compare with other envelope quality control proteins across species

  • Experimental Evolution Approaches:

    • Subject M. succiniciproducens to adaptive laboratory evolution under various stresses

    • Track changes in htpX sequence and expression

    • Characterize evolved variants for altered substrate specificity or activity

    • These experiments could reveal adaptive potential of HtpX

  • Horizontal Gene Transfer Assessment:

    • Analyze evidence for horizontal transfer of htpX genes

    • Identify potential recombination events in evolutionary history

    • Examine functional consequences of such transfers

    • These analyses could reveal the mobility of proteolytic quality control systems

  • Synthetic Biology Integration:

    • Create chimeric HtpX proteins with domains from diverse species

    • Test functional compatibility of components across evolutionary distance

    • Engineer novel specificities based on comparative insights

    • These approaches could both test evolutionary hypotheses and generate biotechnologically useful variants

The table below summarizes key comparative parameters:

Comparative ParameterAnalytical ApproachExpected InsightsResearch Applications
Sequence conservationMultiple sequence alignment, ConSurf analysisIdentification of functionally critical residuesGuide mutagenesis studies
Substrate specificityCross-species activity assaysEvolution of recognition motifsEngineer specificity
Regulatory mechanismsPromoter analysis, transcriptome comparisonDiversification of control mechanismsOptimize expression systems
Environmental adaptationCorrelation with habitat dataSelective pressures on protease functionDevelop condition-specific variants
Functional redundancyMulti-knockout studies across speciesRobustness of proteolytic networksIdentify compensatory mechanisms

These comparative studies would place M. succiniciproducens HtpX in an evolutionary context, enhancing both fundamental understanding and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.