Recombinant Mannose-P-dolichol utilization defect 1 protein homolog (F38E1.9)

Shipped with Ice Packs
In Stock

Description

Functional Role in Glycosylation

F38E1.9 homologs, such as human MPDU1, play a role in flipping DPM and dolichol-phosphate-glucose (DPG) across the endoplasmic reticulum (ER) membrane. Deficiencies in MPDU1 are linked to CDG type I and dystroglycanopathies, characterized by impaired α-dystroglycan (αDG) O-mannosylation . Key functional insights include:

  • Biochemical Role: Facilitates ER-to-Golgi transport of glycoproteins by regulating cargo selectivity .

  • Genetic Interactions: sel-9 (a C. elegans p24 protein) negatively regulates LIN-12/GLP-1 receptor trafficking, highlighting evolutionary conservation in quality control mechanisms .

3.1. Disease Modeling

  • CDG and Muscular Dystrophy: Mutations in MPDU1 disrupt DPM utilization, leading to elevated lipid-linked oligosaccharide (LLO) intermediates (e.g., Man5_5GlcNAc2_2) and reduced Glc3_3Man9_9GlcNAc2_2 levels, as shown in fibroblast studies .

  • Dystroglycanopathy Symptoms: Patients exhibit dilated cardiomyopathy, elevated creatine kinase, and neurological abnormalities, mimicking findings in C. elegans models .

5.1. Genetic and Biochemical Insights

  • Allele-Specific Suppression: sel-9 mutations suppress trafficking defects in LIN-12/GLP-1 receptors with extracellular domain mutations, but not intracellular truncations .

  • DPM Utilization Defects: Fibroblasts from MPDU1-deficient patients show impaired DPM transport into the ER lumen, confirmed via [3H]mannose labeling and HPLC analysis .

5.2. Evolutionary Conservation

  • p24 Protein Family: SEL-9 (F38E1.9 homolog) and F47G9.1 (Erv25/Tmp21 subfamily) regulate glycosylation quality control in C. elegans, mirroring human MPDU1 functions .

Future Directions

  • Therapeutic Targeting: Modulating F38E1.9 activity could rescue glycosylation defects in CDG and muscular dystrophy.

  • Mechanistic Studies: Further structural analysis of DPM flipping mechanisms using recombinant F38E1.9 proteins.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
mpdu-1; F38E1.9; Mannose-P-dolichol utilization defect 1 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F38E1.9
Target Protein Sequence
MNDIIQSLFPGNCFEELLINFNFFHPTCPKAVLSRGLGFAITLGSILLFVPQILKIQAAR SAQGISAASQLLALVGAIGTASYSYRSGFVFSGWGDSFFVAVQLVIIILQIFLFSGQTML SVGFLGIVSAVAYGVVSKSIPMQTLTAVQTAGIPIVVVSKLLQISQNYRAQSTGQLSLIS VFLQFAGTLARVFTSVQDTGDMLLIVSYSTAAVLNGLIFAQFFMYWSHSESAAKKKRN
Uniprot No.

Target Background

Database Links
Protein Families
MPDU1 (TC 2.A.43.3) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of Mannose-P-dolichol utilization defect 1 protein homolog (F38E1.9)?

Mannose-P-dolichol utilization defect 1 protein homolog (F38E1.9) is required for normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and glycosylphosphatidylinositol (GPI) anchors. This protein plays a critical role in glycosylation pathways, which are fundamental cellular processes affecting protein structure and function. In human systems, the ortholog is known as MPDU1 (also called Suppressor of Lec15 and Lec35 glycosylation mutation homolog or SL15), while F38E1.9 refers specifically to the Caenorhabditis elegans homolog. Research indicates that disruptions in this protein's function can lead to significant impairments in glycosylation processes, ultimately affecting multiple cellular functions .

How should I design preliminary experiments to characterize F38E1.9 function?

When designing preliminary experiments for characterizing F38E1.9 function, you should begin by defining your key variables and establishing clear relationships between them. Start with a specific research question, such as "What is the effect of F38E1.9 knockdown on specific glycosylation pathways?" Then identify your independent variable (e.g., F38E1.9 expression levels) and dependent variable (e.g., markers of glycosylation efficiency) .

A systematic approach involves:

  • Establishing appropriate controls (positive, negative, and experimental)

  • Determining appropriate expression systems (bacterial, yeast, mammalian, or C. elegans models)

  • Planning for preliminary validation techniques including Western blotting, immunofluorescence, and activity assays

  • Controlling extraneous variables that might influence your results such as expression levels, post-translational modifications, and experimental conditions

What are the common challenges in producing recombinant F38E1.9 protein?

Producing recombinant F38E1.9 protein presents several challenges that require methodological consideration:

  • Expression system selection: As a membrane-associated protein involved in dolichol metabolism, F38E1.9 often requires eukaryotic expression systems that can properly perform post-translational modifications and membrane integration.

  • Protein solubility: Membrane proteins like F38E1.9 frequently encounter solubility issues. Consider using:

    • Fusion tags (MBP, SUMO, or GST) to enhance solubility

    • Detergent screening to identify optimal solubilization conditions

    • Lipid nanodisc incorporation for maintaining native-like membrane environment

  • Protein purification: Develop a multi-step purification strategy incorporating:

    • Initial capture using affinity chromatography (if tagged)

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Functional validation: Verify that the recombinant protein maintains physiological activity through appropriate functional assays measuring its ability to facilitate Dol-P-Man utilization .

How can I establish a robust experimental design to study F38E1.9 interactions with other glycosylation pathway components?

To establish a robust experimental design for studying F38E1.9 interactions with other glycosylation pathway components, implement a systematic approach that integrates multiple complementary methods:

First, define your specific research hypothesis and identify the key glycosylation pathway components you suspect interact with F38E1.9. Next, design protein-protein interaction studies using techniques such as co-immunoprecipitation, proximity labeling (BioID or APEX), and FRET/BRET assays for in vivo interactions .

Implement a controlled experimental design with the following elements:

  • Between-subjects design: Compare wild-type expression versus F38E1.9 knockout/knockdown models

  • Within-subjects design: Examine effects of mutant variants within the same experimental system

For interaction validation, employ the following complementary approaches:

  • In vitro: Surface plasmon resonance or isothermal titration calorimetry to determine binding kinetics

  • In vivo: Genetic interaction studies using synthetic lethality/suppression in C. elegans

  • Structural: Cross-linking mass spectrometry to map interaction interfaces

Remember to measure your dependent variables (interaction strength, glycosylation efficiency) with appropriate controls for each experimental condition and replicate your experiments sufficiently to enable robust statistical analysis .

What methodological approaches are most effective for analyzing the impact of F38E1.9 mutations on glycosylation pathways?

When analyzing the impact of F38E1.9 mutations on glycosylation pathways, a multi-layered methodological approach yields the most comprehensive results:

  • Glycoproteomic analysis:

    • Use mass spectrometry-based approaches to profile N-linked and O-linked glycan structures

    • Employ stable isotope labeling to quantify changes in glycosylation dynamics

    • Analyze site-specific glycosylation alterations across the proteome

  • Functional complementation assays:

    • Express wild-type and mutant F38E1.9 variants in knockout models

    • Measure restoration of glycosylation phenotypes

    • Quantify dose-dependent effects of expression levels

  • Subcellular localization studies:

    • Use fluorescence microscopy to track protein localization

    • Employ fractionation techniques to assess membrane association

    • Determine colocalization with other glycosylation pathway components

  • Molecular dynamics simulations:

    • Model the structural consequences of specific mutations

    • Predict alterations in protein-lipid or protein-protein interactions

    • Generate testable hypotheses for experimental validation

This integrated approach allows you to correlate structural changes with functional outcomes, providing mechanistic insights into how specific mutations affect glycosylation efficiency .

How can I optimize experimental conditions for studying F38E1.9 in C. elegans models?

Optimizing experimental conditions for studying F38E1.9 in C. elegans requires careful consideration of several methodological parameters:

  • RNA interference and heat shock treatment protocols:

    • Use feeding RNAi with age-synchronized populations for consistent knockdown

    • Implement temperature-sensitive alleles for conditional expression studies

    • Control environmental conditions precisely to minimize variability

  • Sample preparation for molecular analysis:

    • Optimize extraction protocols specifically for membrane proteins

    • Implement sample pooling strategies to account for individual variation

    • Preserve post-translational modifications during isolation procedures

  • Standardized measurement approaches:

    • Develop quantitative phenotyping pipelines for morphological assessments

    • Establish reporter systems for real-time monitoring of glycosylation status

    • Implement automated image analysis for unbiased quantification

  • Life-cycle considerations:

    • Account for developmental timing in experimental designs

    • Standardize age-synchronization protocols for consistent results

    • Control for age-dependent changes in glycosylation patterns

For RNA interference experiments targeting F38E1.9, maintain consistent C. elegans populations on standard nematode growth medium, implementing controlled feeding protocols with dsRNA-expressing bacteria. When applying heat shock treatments, precisely control temperature and duration to ensure reproducibility across experimental replicates .

What variables should be controlled when designing experiments to study F38E1.9 function?

When designing experiments to study F38E1.9 function, control the following variables to ensure robust and reproducible results:

  • Genetic background variables:

    • Use isogenic strains to minimize genetic variation

    • Include appropriate genetic controls (null mutants, rescues)

    • Consider potential genetic modifiers when using different strain backgrounds

  • Environmental variables:

    • Standardize temperature and humidity conditions

    • Control light/dark cycles for experiments spanning multiple days

    • Maintain consistent media composition and batch preparation

  • Technical variables:

    • Standardize protein extraction and purification protocols

    • Calibrate equipment regularly for consistent measurements

    • Use internal standards for quantitative analyses

  • Biological variables:

    • Control for developmental stage and age

    • Account for circadian rhythms if relevant

    • Standardize feeding conditions and nutritional status

For each experiment, explicitly document these controlled variables in your experimental design table:

Variable CategorySpecific VariablesControl MethodValidation Approach
GeneticStrain backgroundUse N2 reference strainGenotyping
GeneticF38E1.9 expressionRNAi knockdown efficiencyqRT-PCR validation
EnvironmentalTemperatureMaintain at 20°C ± 0.5°CContinuous monitoring
EnvironmentalMedia compositionSingle batch preparationQuality control testing
TechnicalProtein extractionStandardized protocolYield and purity assessment
BiologicalDevelopmental stageAge synchronizationVisual confirmation

How should I design experiments to investigate potential interactions between F38E1.9 and HSF-1 pathways?

To investigate potential interactions between F38E1.9 and HSF-1 pathways, design a multi-faceted experimental approach that addresses both genetic and biochemical interactions:

  • Genetic interaction analysis:

    • Implement double knockdown/knockout studies (F38E1.9 and HSF-1)

    • Measure synthetic phenotypes indicating pathway convergence

    • Analyze epistatic relationships through rescue experiments

  • Transcriptional regulation assessment:

    • Perform ChIP-seq to determine if HSF-1 binds to F38E1.9 promoter regions

    • Use reporter constructs to measure F38E1.9 expression under heat stress

    • Analyze F38E1.9 expression in HSF-1 mutant backgrounds

  • Protein-level interaction studies:

    • Conduct co-immunoprecipitation experiments under normal and stress conditions

    • Implement proximity labeling approaches to detect transient interactions

    • Use fluorescence microscopy to assess colocalization during stress responses

  • Functional outcome measurement:

    • Analyze glycosylation efficiency under heat stress conditions

    • Measure heat shock response in F38E1.9 mutant backgrounds

    • Assess longevity and stress resistance phenotypes in single and double mutants

This experimental design allows for comprehensive mapping of potential interactions between F38E1.9 and the HSF-1-regulated stress response pathways that have been implicated in longevity and proteostasis .

How can I apply NIH data table formats to effectively present F38E1.9 research findings?

To effectively present F38E1.9 research findings using NIH data table formats, organize your data according to the following structural guidelines:

  • For presenting participating research personnel and their expertise:
    Use Table 2 format to list researchers involved in F38E1.9 studies, highlighting specialized techniques and previous experience with glycosylation pathway analysis.

  • For summarizing research support and resources:
    Adapt Table 3 and Table 4 formats to document funding sources, equipment access, and collaborative relationships supporting F38E1.9 research.

  • For tracking publications and research outputs:
    Use Table 5A format to comprehensively list publications related to F38E1.9 research, organizing by publication date and impact.

  • For presenting experimental outcomes:
    Create data tables following this format:

Experimental ConditionF38E1.9 Expression LevelGlycosylation EfficiencyPhenotypic OutcomeStatistical Significance
Wild-type100% (reference)NormalNormal developmentN/A
RNAi knockdown15% ± 3%Reduced (65% of WT)Developmental delayp < 0.001
Heat stress (34°C)158% ± 12%Enhanced (125% of WT)Stress resistancep < 0.01
Overexpression340% ± 25%No significant changeMild ER stressp = 0.047

This standardized approach to data presentation ensures your research findings are presented in a format familiar to NIH reviewers, facilitating comparison across studies and enhancing the impact of your F38E1.9 research .

What statistical approaches are most appropriate for analyzing F38E1.9 knockdown phenotypes?

When analyzing F38E1.9 knockdown phenotypes, select statistical approaches that match your experimental design and data characteristics:

  • For comparing phenotypic measurements between control and knockdown conditions:

    • Use t-tests for single comparisons with normally distributed data

    • Implement Mann-Whitney U tests for non-parametric comparisons

    • Apply ANOVA with appropriate post-hoc tests for multiple group comparisons

  • For time-course experiments monitoring glycosylation changes:

    • Use repeated measures ANOVA to account for temporal correlation

    • Consider mixed-effects models to handle missing data points

    • Implement time-series analysis for identifying temporal patterns

  • For correlating F38E1.9 expression levels with phenotypic outcomes:

    • Apply regression analysis to establish dose-response relationships

    • Use multivariate analysis to control for confounding variables

    • Implement principal component analysis to identify patterns in multidimensional data

  • For reproducibility and robustness:

    • Calculate effect sizes alongside p-values

    • Perform power analysis to ensure adequate sample sizes

    • Implement multiple testing corrections for genome-wide studies

How can I integrate transcriptomic and proteomic data to understand F38E1.9 function in glycosylation pathways?

To integrate transcriptomic and proteomic data for understanding F38E1.9 function in glycosylation pathways, implement a multi-layered data integration framework:

  • Data generation and preprocessing:

    • Perform RNA-Seq on F38E1.9 knockdown versus control samples

    • Conduct quantitative proteomics focusing on glycoproteins

    • Implement glycomic profiling to characterize glycan structures

    • Ensure consistent sample preparation across all platforms

  • Multi-omics integration strategy:

    • Correlate transcript and protein abundance changes

    • Identify discordant changes suggesting post-transcriptional regulation

    • Map affected pathways using integrated pathway analysis

    • Apply network analysis to identify regulatory hubs

  • Functional validation approaches:

    • Select candidate genes/proteins for follow-up studies

    • Design targeted experiments to verify predicted interactions

    • Implement genetic screens to identify synthetic interactions

  • Computational analysis tools:

    • Use specialized software packages for integrating multi-omics data

    • Implement machine learning approaches to identify patterns

    • Develop predictive models of glycosylation pathway function

What are the best approaches for distinguishing direct versus indirect effects of F38E1.9 manipulation?

To distinguish direct versus indirect effects of F38E1.9 manipulation, employ a strategic combination of temporal, genetic, and biochemical approaches:

  • Temporal resolution studies:

    • Implement time-course experiments following F38E1.9 disruption

    • Track early versus late response genes/proteins

    • Use pulse-chase labeling to monitor glycoprotein synthesis and processing

    • Analyze the temporal order of glycosylation defects

  • Genetic interaction mapping:

    • Create an epistasis map using double knockdown/knockout approaches

    • Identify suppressors and enhancers of F38E1.9 phenotypes

    • Use conditional alleles to control timing of genetic disruption

    • Implement genetic bypass experiments to test pathway relationships

  • Biochemical proximity analysis:

    • Use protein-protein interaction detection methods (BioID, APEX)

    • Identify physical binding partners of F38E1.9

    • Map the subcellular localization of effects using fractionation

    • Compare interactome changes under normal versus disrupted conditions

  • Computational network analysis:

    • Construct directed networks from multi-omics data

    • Apply causality inference algorithms to identify likely direct targets

    • Use existing knowledge databases to filter potential interactions

    • Develop predictive models distinguishing primary from secondary effects

This multi-faceted approach enables effective discrimination between direct consequences of F38E1.9 function and downstream cascading effects, providing clearer mechanistic insights into its role in glycosylation pathways .

How can I address inconsistent results when studying F38E1.9 function across different experimental systems?

When encountering inconsistent results in F38E1.9 functional studies across different experimental systems, implement a systematic troubleshooting approach:

  • Standardize expression systems:

    • Compare protein expression levels quantitatively across systems

    • Verify correct subcellular localization in each system

    • Assess post-translational modifications that may differ between systems

    • Consider species-specific interaction partners

  • Validate knockdown/knockout efficiency:

    • Implement multiple validation methods (qPCR, Western blot)

    • Measure residual activity rather than just expression

    • Check for compensatory mechanisms that may be system-specific

    • Test multiple knockdown methods (RNAi, CRISPR, morpholinos)

  • Harmonize experimental conditions:

    • Standardize buffer compositions and pH

    • Control temperature conditions precisely

    • Synchronize developmental timing when relevant

    • Match nutrient conditions across systems

  • Implement cross-validation strategies:

    • Test key findings using complementary techniques

    • Collaborate with laboratories using different methodologies

    • Compare your findings with published results for related proteins

    • Develop system-specific positive controls

Document all methodological differences between experimental systems in a comparative analysis table, systematically testing each variable to identify the source of inconsistency. This methodical approach allows you to determine whether discrepancies reflect technical issues or genuine biological differences in F38E1.9 function across systems .

What strategies can help resolve contradictory data regarding F38E1.9 interactions with glycosylation pathway components?

When facing contradictory data regarding F38E1.9 interactions with glycosylation pathway components, implement the following resolution strategies:

  • Methodological reconciliation:

    • Compare detection methods for sensitivity and specificity limitations

    • Evaluate buffer conditions that may affect transient interactions

    • Consider tag position effects that might mask interaction domains

    • Test interactions under different cellular stress conditions

  • Controlled validation experiments:

    • Design direct comparison studies using standardized protocols

    • Implement orthogonal detection methods for key interactions

    • Use recombinant proteins to test direct binding in vitro

    • Create domain mutants to map interaction regions precisely

  • Context-dependent interaction analysis:

    • Test interactions under varying physiological conditions

    • Examine cell/tissue type specificity of interactions

    • Investigate developmental timing effects

    • Assess the impact of post-translational modifications

  • Integrative data assessment:

    • Implement Bayesian integration of contradictory evidence

    • Weight results based on methodological rigor

    • Develop consensus models incorporating partially contradictory data

    • Distinguish core interactions from conditional ones

Present your findings in a reconciliation matrix that explicitly addresses conflicting results, proposing a unified model that accounts for methodological differences and biological context. This systematic approach transforms seemingly contradictory results into a more nuanced understanding of F38E1.9's dynamic interaction network .

How should I address challenges in reproducing published findings related to F38E1.9 function?

When addressing reproducibility challenges with published F38E1.9 findings, implement this structured approach:

  • Methodological alignment:

    • Carefully compare your protocols with published methods

    • Contact original authors for clarification on undocumented details

    • Obtain original materials (plasmids, antibodies, strains) when possible

    • Identify critical parameters that might affect outcomes

  • Systematic variation analysis:

    • Test key reagents from multiple sources

    • Vary experimental conditions systematically

    • Implement blinded analysis to prevent confirmation bias

    • Calculate effect sizes to assess biological significance

  • Statistical reassessment:

    • Evaluate power and sample sizes in original and reproduction studies

    • Consider batch effects and their potential impact

    • Implement robust statistical methods less sensitive to outliers

    • Assess whether differences are statistically significant or simply noise

  • Transparent reporting:

    • Document all attempts at reproduction, successful or not

    • Maintain detailed laboratory records of all variables

    • Share your findings with original authors before publication

    • Consider publishing a methods-focused paper addressing reproducibility

Create a detailed comparison table between original and reproduction attempts:

Experimental FactorOriginal PublicationYour ProtocolDifferencePotential Impact
Expression systemHEK293T cellsCOS-7 cellsCell typeMay affect glycosylation patterns
Antibody usedCustom polyclonalCommercial monoclonalEpitope recognitionCould affect detection sensitivity
Buffer composition150mM NaCl, pH 7.4100mM NaCl, pH 7.2Ionic strength, pHMay alter protein interactions
Statistical approacht-test, n=3ANOVA, n=6Statistical powerDifferent significance threshold

This systematic approach transforms reproducibility challenges into opportunities for deeper understanding of the contextual factors affecting F38E1.9 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.