Recombinant Mannose permease IIC component (manY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
manY; Z2861; ECs2528; PTS system mannose-specific EIIC component; EII-P-Man; EIIC-Man; Mannose permease IIC component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
manY
Target Protein Sequence
MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIA LGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAF QHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTN GLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ LSPKYNRVAGAPAQAAGNNDLDNELD
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a primary carbohydrate transport system, catalyzes the phosphorylation and translocation of sugar substrates across the cell membrane. The enzyme II ManXYZ PTS system is specifically involved in mannose transport.
Database Links

KEGG: ece:Z2861

STRING: 155864.Z2861

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mannose permease IIC component and what is its role in bacterial transport systems?

The mannose permease IIC component (manY) is an integral membrane protein that forms part of the mannose phosphotransferase system (PTS). It functions as a critical component of the membrane-spanning domain that facilitates sugar transport across the bacterial membrane. The mannose transporter (IIMan) is composed of four domains expressed as two proteins: the soluble IIABMan component associates with the integral membrane IICDMan permease . The IIC component specifically forms the channel through which sugar molecules pass during transport and phosphorylation.

How does the mannose permease IIC component interact with other PTS components?

The mannose permease IIC component works in coordination with other PTS proteins in a phosphoryl transfer cascade. Research shows that IIAMan accepts a phosphoryl group from HPr and donates it to IIBMan . The IIBMan mediates contacts with the transmembrane IICDMan permease (which includes the IIC component) and phosphorylates the incoming mannose at the O-6′ position . The active site histidines play crucial roles in this phosphoryl transfer mechanism, with a convex surface on HPr interacting with a deep groove at the interface of the two subunits of IIAMan .

How is the expression of the mannose permease IIC component regulated?

Expression of the mannose permease components is regulated by specific regulatory proteins. In Listeria monocytogenes, for example, the mpt operon (which encodes mannose PTS components) is regulated by ManR and Lmo0095 . Real-time reverse transcription-PCR analysis showed that mpt mRNA levels were 10-fold lower in lmo0095 deletion strains and 100-fold lower in manR deletion strains . This indicates that both regulators are required for full expression, with ManR having a stronger activating effect. Interestingly, glucose presence in the medium affects this regulation, suggesting a feedback mechanism linked to substrate availability .

What experimental approaches are most effective for studying recombinant mannose permease IIC component function?

When designing experiments to study recombinant mannose permease IIC component function, researchers should follow a systematic approach:

  • Begin by clearly defining variables: independent variables (different constructs or conditions), dependent variables (transport activity, protein interactions), and controlling for extraneous variables that might confound results .

  • Implement a multi-technique strategy including:

    • Genetic approaches: gene deletion and complementation studies

    • Biochemical assays: transport assays using radiolabeled substrates

    • Structural studies: membrane protein crystallization or cryo-EM

    • Interaction studies: bacterial two-hybrid systems or co-immunoprecipitation

  • Design appropriate controls including:

    • Negative controls with unrelated membrane proteins

    • Positive controls with known functional variants

    • Expression level controls to ensure comparable protein amounts

  • Apply rigorous statistical analysis to determine significance of results and establish cause-effect relationships .

For membrane proteins like manY, particular attention must be paid to maintaining native conformation through appropriate detergent selection and membrane mimetics during purification and analysis.

How should researchers design experiments to study interactions between mannose permease IIC component and other PTS proteins?

Studying protein-protein interactions involving membrane proteins like manY requires specialized experimental design:

  • Define clear research questions and formulate testable hypotheses about the interaction interfaces .

  • Select complementary approaches:

    • In vivo approaches: bacterial two-hybrid systems, FRET, or split-protein complementation

    • In vitro approaches: co-immunoprecipitation, surface plasmon resonance with detergent-solubilized proteins

    • Structural approaches: crosslinking followed by mass spectrometry analysis

  • Design controls for specificity:

    • Test interaction with unrelated membrane proteins

    • Create mutations in predicted interaction interfaces

    • Verify that detergents do not disrupt natural interactions

  • Systematically manipulate variables while controlling for extraneous factors that might affect the interactions .

Based on existing research, interactions between HPr and IIAMan involve a convex surface on HPr, formed primarily by helices 1 and 2, which interacts with a deep groove at the interface of the two subunits of IIAMan . Similar systematic approaches should be applied when studying interactions involving the IIC component.

How should researchers analyze contradictory data regarding mannose permease IIC component function?

When faced with contradictory data about mannose permease IIC component function, researchers should apply a structured approach to resolve these conflicts:

For example, if contradictory results emerge regarding substrate specificity, researchers should carefully examine whether the protein was studied in isolation or as part of the complete PTS complex, as this could significantly affect observed function.

How can researchers effectively present and interpret data from mannose permease IIC transport studies?

Effective presentation of transport data requires careful consideration of format and analysis. Based on data presentation principles, researchers should:

  • Present quantitative data in both tabular and graphical formats with clear explanations of how to interpret the results .

  • Include statistical measures such as standard deviations and significance values for all key measurements.

  • Create structured data tables showing relevant parameters:

Protein VariantSubstrateKm (μM)Vmax (nmol/min/mg)Specificity Constant (Vmax/Km)
Wild-type manYMannose25 ± 3150 ± 126.0 ± 0.7
Wild-type manYGlucose40 ± 5120 ± 103.0 ± 0.5
H225A mutantMannose100 ± 880 ± 70.8 ± 0.1
H225A mutantGlucose150 ± 1260 ± 60.4 ± 0.06
  • Provide context by comparing results to relevant literature and explaining the implications for understanding transport mechanism.

  • Ensure all figures and tables are self-explanatory with detailed captions that allow readers to interpret data independently .

What are the best protocols for expressing and purifying recombinant mannose permease IIC component?

The expression and purification of integral membrane proteins like mannose permease IIC component presents significant challenges requiring specialized protocols:

  • Expression system selection:

    • E. coli C43(DE3) or C41(DE3) strains developed for toxic membrane proteins

    • Consider fusion tags (His, MBP, SUMO) to improve folding and stability

    • Optimize expression conditions (temperature, inducer concentration, duration)

  • Membrane preparation and solubilization:

    • Harvest cells and disrupt by mechanical methods

    • Isolate membranes by differential centrifugation

    • Solubilize using mild detergents (DDM, LMNG) that maintain native conformation

  • Purification strategy:

    • Affinity chromatography using engineered tags

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Quality control:

    • Assess purity by SDS-PAGE

    • Verify conformation by circular dichroism

    • Confirm activity by reconstitution into proteoliposomes followed by transport assays

The experimental design should systematically evaluate different variables (expression conditions, detergents, purification methods) to identify optimal conditions for obtaining functional protein .

How can researchers effectively use site-directed mutagenesis to study structure-function relationships in mannose permease IIC component?

Site-directed mutagenesis is a powerful approach to understand structure-function relationships in manY:

  • Strategic mutation design:

    • Target conserved residues identified through sequence alignments

    • Focus on predicted functional regions (substrate binding sites, protein interfaces)

    • Create systematic alanine-scanning libraries of transmembrane regions

    • Design mutations based on structural models or homology to related transporters

  • Functional characterization:

    • Assess expression and membrane integration of mutants

    • Measure transport activity using radiolabeled substrates

    • Determine kinetic parameters (Km, Vmax) for active mutants

    • Evaluate protein-protein interactions with other PTS components

  • Data analysis and interpretation:

    • Classify mutations based on effect (inactive, reduced activity, altered specificity)

    • Map mutations onto structural models to identify functional motifs

    • Correlate mutation effects with predicted structural elements

By systematically manipulating independent variables (specific residues) while measuring dependent variables (transport activity, interactions), researchers can establish causal relationships between sequence elements and function .

How does the mannose permease IIC component contribute to bacterial virulence regulation?

The mannose permease system, including the IIC component, plays significant roles in virulence regulation in certain bacteria:

  • In Listeria monocytogenes, the mannose PTS permease (EIItMan) participates in glucose-mediated carbon catabolite repression (CCR) and downregulation of virulence gene expression .

  • The system serves as the receptor for class IIa bacteriocins, affecting bacterial susceptibility to these antimicrobial peptides .

  • Research shows that deletion of mpt operon components can significantly alter virulence gene expression. Quantification of mRNA levels through real-time reverse transcription-PCR demonstrates that disruption of the mannose PTS affects expression of PrfA-regulated virulence genes .

  • The effect on virulence appears to involve a regulatory cascade where glucose transport through the mannose PTS triggers carbon catabolite repression via CcpA-dependent mechanisms .

These findings highlight the importance of studying the mannose PTS beyond its role in sugar transport, particularly in pathogenic bacteria where it may serve as a link between metabolism and virulence.

What experimental approaches can determine the substrate specificity of mannose permease IIC component variants?

Determining substrate specificity of mannose permease IIC component variants requires systematic experimental approaches:

  • Genetic system development:

    • Create clean deletion mutants lacking native mannose permeases

    • Complement with recombinant manY variants under controlled expression

  • Transport assay design:

    • Use radiolabeled sugars (mannose, glucose, fructose, etc.)

    • Measure initial transport rates at varying substrate concentrations

    • Perform competition assays with unlabeled sugars

  • Kinetic analysis:

    • Determine Km and Vmax for each substrate

    • Calculate specificity constants (Vmax/Km) to compare transport efficiency

    • Analyze inhibition patterns to characterize binding site properties

  • Structure-function correlation:

    • Create mutations in putative substrate-binding regions

    • Correlate altered specificity profiles with structural changes

    • Develop predictive models of substrate recognition

This systematic approach allows researchers to manipulate independent variables (substrate type, concentration) while measuring dependent variables (transport rates) to establish specificity profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.