Recombinant Marchantia polymorpha Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.

Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
petA
Target Protein Sequence
FPIYAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAVVKIPYDMQIKQV LANGKKGSLNVGAVLILPEGFELAPSDRIPPEMKEKIGNLFFQPYSNDKKNILVIGPVPG KKYSEMVFPILSPDPATNKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASITGKVS KIFRKEKGGYEITIDDISDGHKVVDISAAGPELIISEGELVKVDQPLTNNPNVGGFGQGD AEVVLQDPLRIQGLLLFFGSVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of cytochrome f in the photosynthetic electron transport chain?

Cytochrome f is a critical component of the cytochrome bf complex in the chloroplast thylakoid membrane. It functions primarily in transferring electrons from the Rieske FeS center to plastocyanin within the photosynthetic electron transfer chain . The protein is anchored to the thylakoid membrane by a hydrophobic membrane-spanning region located near its C-terminus, with the majority of the protein extending into the thylakoid lumen where it can interact with plastocyanin . This interaction is crucial for efficient photosynthetic electron transport, making cytochrome f an essential protein for photosynthetic organisms.

How does the structure of Marchantia polymorpha cytochrome f compare to that of other plant species?

Marchantia polymorpha cytochrome f shares the core structural features found in other plant species, including a hydrophobic patch surrounding the haem group that facilitates interaction with plastocyanin. Based on research with other species like turnip, specific amino acid residues in this hydrophobic patch (such as Y1, F4, Q7, and Y160) play important roles in plastocyanin binding and electron transfer efficiency . While maintaining these conserved features, M. polymorpha cytochrome f exhibits certain bryophyte-specific structural adaptations that reflect its evolutionary position. Researchers studying recombinant M. polymorpha cytochrome f should pay particular attention to these conserved residues when designing mutagenesis experiments.

What are the characteristics of the petA gene in Marchantia polymorpha?

The petA gene in M. polymorpha is located in the chloroplast genome and encodes the apocytochrome f protein. Like other plastid genes, it exhibits maternal inheritance patterns typical of organellar DNA . The gene structure includes regions encoding the hydrophobic membrane anchor near the C-terminus and domains involved in protein-protein interactions. When working with recombinant versions, researchers should note that truncated forms lacking the C-terminal membrane anchor (approximately 33 amino acids) can be expressed as soluble proteins while maintaining functional electron transfer capabilities, as demonstrated with turnip cytochrome f .

How do mutations in the hydrophobic patch of cytochrome f affect its interaction with plastocyanin?

Mutations in the hydrophobic patch surrounding the haem group can significantly alter cytochrome f's interaction with plastocyanin, affecting both binding constants and electron transfer rates. Research with turnip cytochrome f has demonstrated that different mutations have varying effects:

These findings indicate that even subtle changes in the hydrophobic patch can influence electron transfer rates by altering both the binding constant with plastocyanin and the midpoint redox potential of the cytochrome haem group . When designing site-directed mutagenesis experiments with M. polymorpha cytochrome f, researchers should consider these structure-function relationships and predict similar effects if targeting homologous residues.

What are the challenges in expressing recombinant Marchantia polymorpha apocytochrome f in heterologous systems?

Expression of M. polymorpha apocytochrome f in heterologous systems presents several challenges. First, ensuring proper folding and haem incorporation is critical for obtaining functional protein. When expressing in E. coli, targeting the protein to the periplasmic space has proven effective for other cytochrome f proteins, as this compartment provides the oxidizing environment needed for proper disulfide bond formation .

Second, researchers must consider whether to express the full-length protein (including the membrane anchor) or a truncated version. Truncated versions lacking the C-terminal membrane anchor can be purified as soluble proteins while maintaining electron transfer functionality . For membrane-bound versions, appropriate detergents must be selected for solubilization and purification.

Third, codon optimization may be necessary when expressing the chloroplast-encoded gene in bacterial systems due to differences in codon usage bias. Additionally, heterologous expression systems may lack specific chaperones or assembly factors present in chloroplasts that facilitate proper folding and haem incorporation.

How can chloroplast transformation be used to study cytochrome f function in Marchantia polymorpha?

Direct chloroplast transformation offers significant advantages for studying cytochrome f function in M. polymorpha. Unlike nuclear transformation, chloroplast transformation allows for homologous recombination, enabling precise modification of the petA gene in its native genomic context . This approach permits the introduction of site-specific mutations to study structure-function relationships or the addition of epitope tags for protein localization and interaction studies.

For successful chloroplast transformation in M. polymorpha:

  • Design species-specific vectors containing homologous flanking sequences to target integration to the desired location in the chloroplast genome

  • Include appropriate selectable markers (e.g., spectinomycin resistance)

  • Use biolistic delivery methods to introduce the DNA into chloroplasts

  • Select for transformants and screen for homoplasmy (complete replacement of wild-type chloroplast genomes)

  • Verify integration by PCR and sequencing

  • Confirm expression of the recombinant protein by immunoblotting

This approach allows for high-level expression of the recombinant protein due to the high copy number of the chloroplast genome in each cell . Additionally, since transgenes in the chloroplast are maternally inherited, there is reduced risk of gene flow through pollen .

What expression systems are most effective for producing recombinant Marchantia polymorpha apocytochrome f?

Several expression systems can be employed for producing recombinant M. polymorpha apocytochrome f, each with distinct advantages:

  • E. coli periplasmic expression: Similar to the approach used for turnip cytochrome f, targeting the protein to the E. coli periplasm can facilitate proper folding and haem incorporation . This system is particularly effective for truncated versions lacking the membrane anchor. Use of specialized E. coli strains that enhance disulfide bond formation (e.g., Origami) can improve yield of correctly folded protein.

  • Direct chloroplast transformation: Expression in the native chloroplast environment ensures proper folding and post-translational modifications. This approach allows for high-level expression (up to 46% of total leaf protein) due to the high copy number of the chloroplast genome .

  • Heterologous chloroplast transformation: Expression in tobacco or other plant chloroplasts using species-specific vectors can provide a platform for producing larger quantities of recombinant protein while maintaining the chloroplast environment for proper folding .

When selecting an expression system, researchers should consider their specific experimental needs, including required protein quantity, downstream applications, and whether native post-translational modifications are necessary.

What purification strategies are recommended for recombinant cytochrome f?

Purification of recombinant cytochrome f requires a systematic approach tailored to the expression system used:

  • For periplasmic expression in E. coli:

    • Extract periplasmic proteins using osmotic shock

    • Conduct initial purification using ammonium sulfate fractionation

    • Employ ion exchange chromatography (typically using CM or DEAE resins)

    • Further purify using size exclusion chromatography

    • Verify purity using SDS-PAGE and spectroscopic analysis of the haem group

  • For chloroplast-expressed protein:

    • Homogenize leaf tissue in appropriate buffer

    • Use differential centrifugation to isolate chloroplasts

    • Solubilize thylakoid membranes with mild detergents (for membrane-bound versions)

    • Purify using affinity chromatography (if tagged) or ion exchange chromatography

    • Conduct final purification using size exclusion chromatography

For both approaches, special attention should be paid to buffer composition, including pH, ionic strength, and the presence of reducing agents, which can significantly affect protein stability and haem retention.

How can researchers assess the functional integrity of purified recombinant cytochrome f?

Assessing the functional integrity of purified recombinant cytochrome f involves multiple complementary approaches:

  • Spectroscopic analysis: UV-visible spectroscopy to verify the characteristic absorption peaks of properly incorporated haem (typical peaks at approximately 420 nm for oxidized and 550 nm for reduced forms).

  • Redox potential measurement: Determine the midpoint redox potential using potentiometric titrations. Functional cytochrome f typically has a midpoint potential around +365 mV .

  • Electron transfer activity: Measure electron transfer rates to plastocyanin using stopped-flow spectroscopy. This provides a direct assessment of biological function. Researchers should compare kinetic parameters (such as second-order rate constants) with published values for wild-type proteins .

  • Binding assays: Quantify the binding constant (Ka) with plastocyanin using techniques such as isothermal titration calorimetry or surface plasmon resonance.

  • Structural integrity: Use circular dichroism spectroscopy to assess secondary structure content, and 1H-NMR spectroscopy to compare with spectra of native proteins .

A comprehensive assessment should include multiple methods to ensure both structural and functional integrity of the recombinant protein.

How should researchers interpret changes in electron transfer rates resulting from mutations in cytochrome f?

When interpreting changes in electron transfer rates resulting from mutations in cytochrome f, researchers should consider multiple factors that can affect these rates:

  • Binding constant effects: Changes in the binding constant (Ka) with plastocyanin directly impact electron transfer efficiency. A decreased binding constant typically leads to reduced electron transfer rates due to less efficient complex formation .

  • Redox potential shifts: Mutations can alter the midpoint redox potential of the haem group, changing the driving force for electron transfer. A lower redox potential generally increases the driving force for electron transfer to plastocyanin .

  • Structural perturbations: Mutations may cause local or global structural changes that alter the distance or orientation between the electron donor (haem in cytochrome f) and acceptor (copper in plastocyanin).

  • Compensatory effects: In some cases, negative effects on binding constants may be partially compensated by favorable changes in redox potential, as observed with the Y160S mutation in turnip cytochrome f .

Researchers should dissect these individual contributions by measuring both electron transfer rates and the underlying parameters (binding constants, redox potentials) to develop a comprehensive understanding of structure-function relationships.

What approaches can be used to study the interaction between recombinant cytochrome f and plastocyanin?

Several complementary approaches can be employed to study the interaction between recombinant cytochrome f and plastocyanin:

  • Kinetic analysis: Use stopped-flow spectroscopy to measure electron transfer rates under various conditions (ionic strength, pH, temperature). This allows determination of second-order rate constants and activation parameters .

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to determine binding constants, stoichiometry, and thermodynamic parameters

    • Surface plasmon resonance (SPR) to measure association and dissociation rates

    • Microscale thermophoresis for solution-based binding measurements

  • Structural studies:

    • NMR spectroscopy to identify specific residues involved in the interaction

    • X-ray crystallography of the complex

    • Cross-linking followed by mass spectrometry to identify interaction interfaces

  • Computational approaches:

    • Molecular docking to predict binding orientations

    • Molecular dynamics simulations to study the dynamics of the complex

    • Electrostatic calculations to analyze the role of charge-charge interactions

By combining these approaches, researchers can develop a comprehensive model of the cytochrome f-plastocyanin interaction that integrates structural, thermodynamic, and kinetic perspectives.

How can researchers address low expression yields of recombinant cytochrome f?

Low expression yields of recombinant cytochrome f can be addressed through several strategies:

  • Optimize codon usage: Adapt the sequence to the codon bias of the expression host to improve translation efficiency.

  • Adjust growth conditions: For E. coli expression, test different temperatures, induction times, and inducer concentrations. Lower temperatures (16-25°C) often favor proper folding of complex proteins.

  • Enhance haem incorporation: Supplement growth media with δ-aminolevulinic acid, a haem precursor, to ensure adequate haem availability. Consider co-expression of haem lyase or other proteins involved in haem biosynthesis and incorporation.

  • Test different signal sequences: For periplasmic expression, evaluate different signal peptides to optimize translocation efficiency.

  • Consider fusion partners: N-terminal fusion with solubility-enhancing tags (e.g., MBP, SUMO) can improve expression and folding, provided these can be removed without affecting protein function.

  • For chloroplast expression: Optimize 5' and 3' untranslated regions to enhance translation efficiency. Both light-regulated (psbA) and constitutive (16S rRNA) promoters can be effective for high-level expression in chloroplasts .

Systematic optimization of these parameters can significantly improve yields of functional recombinant cytochrome f.

What strategies can help overcome challenges in achieving proper folding and haem incorporation?

Proper folding and haem incorporation are critical challenges when working with recombinant cytochrome f. Several strategies can improve these aspects:

  • Expression compartment selection: Target expression to oxidizing environments like the E. coli periplasm or directly in chloroplasts to facilitate disulfide bond formation .

  • Host strain selection: Use E. coli strains with enhanced disulfide bond formation capabilities (e.g., Origami, SHuffle) or strains engineered to produce higher levels of haem.

  • Chaperone co-expression: Co-express molecular chaperones that assist in protein folding, particularly those specific to cytochrome maturation.

  • Optimize haem availability: Supplement growth media with δ-aminolevulinic acid and iron to ensure adequate haem synthesis. Consider timing of haem precursor addition relative to protein induction.

  • Expression rate modulation: Slow down translation by reducing temperature and inducer concentration to allow more time for proper folding and haem incorporation.

  • Buffer optimization: During purification, include stabilizing agents like glycerol and ensure appropriate redox conditions to maintain haem association and protein stability.

  • Refolding protocols: If inclusion bodies form, develop refolding protocols that include controlled oxidation steps and haem addition to recover functional protein.

These approaches often need to be combined and optimized for the specific expression system and protein variant being studied.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.