Recombinant Marchantia polymorpha ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP6 is a core component of the mitochondrial F₀ domain, facilitating proton translocation across the inner membrane to drive ATP synthesis. Key functional insights:

  • Proton channel: Contains conserved residues (e.g., arginine in helix 5) critical for electrostatic interactions with subunit c (c-ring) during proton transport .

  • Assembly: Requires chaperones like Atp10 and Atp23 for stability and integration into the F₀ complex .

3.1. Biochemical Studies

  • SDS-PAGE analysis: Used to verify purity and molecular weight .

  • ELISA: Commercial kits (e.g., MyBioSource) enable quantitative detection in mitochondrial extracts .

3.2. Comparative Mitochondrial Research

  • RNA editing defects: In Sorghum bicolor, reduced atp6 RNA editing correlates with cytoplasmic male sterility (CMS), highlighting its role in pollen development .

  • Chimeric ORFs: In Mimulus guttatus, rearrangements near atp6 are linked to CMS, suggesting evolutionary conservation of its regulatory regions .

Production and Handling Protocols

  • Reconstitution: Dissolve in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Working aliquots stored at 4°C retain activity for ≤1 week .

Evolutionary and Medical Relevance

  • Conservation: ATP6 homologs in bovines (UniProt P00847) and yeast share structural motifs, underscoring its essential role across eukaryotes .

  • Human diseases: Mutations in human MT-ATP6 cause mitochondrial encephalopathies, making Marchantia’s ATP6 a model for studying pathogenic variants .

Key Research Findings

  • Cell-type-specific editing: In CMS Sorghum, atp6 RNA editing drops to 20% in sterile anthers vs. 100% in fertile lines, restored in hybrids (F1/F2) .

  • Assembly-coupled translation: Yeast studies show ATP6 synthesis increases when assembly intermediates accumulate, suggesting feedback regulation .

Comparative Analysis of ATP6 Across Species

SpeciesMarchantia polymorphaBos taurusSaccharomyces cerevisiae
GeneATP6 (mtDNA)MT-ATP6 (mtDNA)ATP6 (mtDNA)
Protein Length252 aa226 aa248 aa
Key FunctionProton channelProton channelProton channel
Disease AssociationN/ALeigh syndromeN/A

Future Directions

  • Structural biology: Cryo-EM studies to resolve proton translocation mechanisms.

  • Agricultural engineering: Modifying atp6 RNA editing to restore fertility in CMS crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
ATP6
Target Protein Sequence
MACSPLEQFAIIQLIPIHIGNLYFSFTNSSLFMLLTISLVLLLVHFVTLNGGNLVPNAWQ SFVEMIYDFVLNLVNEQISGASSVKQRFFPLIYVTFTFLLFCNLIGMIPYSFTVTSHFII TLGLSFSLFIGITIVGFQTHGLHFFSILLPQGVPLPLAPFLVLLELISYCFRALSLGIRL FANMMAGHSLVKILSGFAWTMLSMGGILYLGQLAPFFIVFALTGLELGVAILQAYVFTIL LCIYLNDAINLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) catalyzes the synthesis of ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. ATP synthase subunit a is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.